Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   AB1F75_RS08590 Genome accession   NZ_CP160396
Coordinates   1644677..1645051 (+) Length   124 a.a.
NCBI ID   WP_015251714.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain BSP1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1639677..1650051
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB1F75_RS08550 (AB1F75_08550) corA 1639745..1640698 (+) 954 WP_004399136.1 magnesium transporter CorA -
  AB1F75_RS08555 (AB1F75_08555) - 1640700..1640897 (+) 198 WP_014480259.1 CBS domain-containing protein -
  AB1F75_RS08560 (AB1F75_08560) comGA 1641111..1642181 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  AB1F75_RS08565 (AB1F75_08565) comGB 1642168..1643205 (+) 1038 WP_044052501.1 comG operon protein ComGB Machinery gene
  AB1F75_RS08570 (AB1F75_08570) comGC 1643219..1643515 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  AB1F75_RS08575 (AB1F75_08575) comGD 1643505..1643936 (+) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  AB1F75_RS08580 (AB1F75_08580) comGE 1643920..1644267 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  AB1F75_RS08585 (AB1F75_08585) comGF 1644293..1644676 (+) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  AB1F75_RS08590 (AB1F75_08590) comGG 1644677..1645051 (+) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  AB1F75_RS08595 (AB1F75_08595) spoIITA 1645122..1645302 (+) 181 Protein_1684 YqzE family protein -
  AB1F75_RS08600 (AB1F75_08600) yqzG 1645344..1645670 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  AB1F75_RS08605 (AB1F75_08605) tapA 1645942..1646703 (+) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  AB1F75_RS08610 (AB1F75_08610) sipW 1646687..1647259 (+) 573 WP_003246088.1 signal peptidase I SipW -
  AB1F75_RS08615 (AB1F75_08615) tasA 1647323..1648108 (+) 786 WP_015251717.1 biofilm matrix protein TasA -
  AB1F75_RS08620 (AB1F75_08620) sinR 1648201..1648536 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AB1F75_RS08625 (AB1F75_08625) sinI 1648570..1648743 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  AB1F75_RS08630 (AB1F75_08630) yqhG 1648926..1649720 (-) 795 WP_003230200.1 YqhG family protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14540.73 Da        Isoelectric Point: 8.7849

>NTDB_id=1020808 AB1F75_RS08590 WP_015251714.1 1644677..1645051(+) (comGG) [Bacillus subtilis subsp. subtilis strain BSP1]
MYRTRGFIYPAVLFVSALVLLIVNFTAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1020808 AB1F75_RS08590 WP_015251714.1 1644677..1645051(+) (comGG) [Bacillus subtilis subsp. subtilis strain BSP1]
ATGTACCGTACGAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTACTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATCGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAGCTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

96.774

100

0.968

Multiple sequence alignment