Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AB1F75_RS08625 | Genome accession | NZ_CP160396 |
| Coordinates | 1648570..1648743 (-) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain BSP1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1643570..1653743
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB1F75_RS08580 (AB1F75_08580) | comGE | 1643920..1644267 (+) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
| AB1F75_RS08585 (AB1F75_08585) | comGF | 1644293..1644676 (+) | 384 | WP_015251713.1 | ComG operon protein ComGF | Machinery gene |
| AB1F75_RS08590 (AB1F75_08590) | comGG | 1644677..1645051 (+) | 375 | WP_015251714.1 | ComG operon protein ComGG | Machinery gene |
| AB1F75_RS08595 (AB1F75_08595) | spoIITA | 1645122..1645302 (+) | 181 | Protein_1684 | YqzE family protein | - |
| AB1F75_RS08600 (AB1F75_08600) | yqzG | 1645344..1645670 (-) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| AB1F75_RS08605 (AB1F75_08605) | tapA | 1645942..1646703 (+) | 762 | WP_015251716.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AB1F75_RS08610 (AB1F75_08610) | sipW | 1646687..1647259 (+) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| AB1F75_RS08615 (AB1F75_08615) | tasA | 1647323..1648108 (+) | 786 | WP_015251717.1 | biofilm matrix protein TasA | - |
| AB1F75_RS08620 (AB1F75_08620) | sinR | 1648201..1648536 (-) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| AB1F75_RS08625 (AB1F75_08625) | sinI | 1648570..1648743 (-) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| AB1F75_RS08630 (AB1F75_08630) | yqhG | 1648926..1649720 (-) | 795 | WP_003230200.1 | YqhG family protein | - |
| AB1F75_RS08635 (AB1F75_08635) | hepAA | 1649741..1651413 (-) | 1673 | Protein_1692 | SNF2-related protein | - |
| AB1F75_RS08640 (AB1F75_08640) | gcvT | 1651855..1652943 (+) | 1089 | WP_015251720.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=1020810 AB1F75_RS08625 WP_003230187.1 1648570..1648743(-) (sinI) [Bacillus subtilis subsp. subtilis strain BSP1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1020810 AB1F75_RS08625 WP_003230187.1 1648570..1648743(-) (sinI) [Bacillus subtilis subsp. subtilis strain BSP1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |