Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   AB1F75_RS08585 Genome accession   NZ_CP160396
Coordinates   1644293..1644676 (+) Length   127 a.a.
NCBI ID   WP_015251713.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain BSP1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1639293..1649676
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB1F75_RS08550 (AB1F75_08550) corA 1639745..1640698 (+) 954 WP_004399136.1 magnesium transporter CorA -
  AB1F75_RS08555 (AB1F75_08555) - 1640700..1640897 (+) 198 WP_014480259.1 CBS domain-containing protein -
  AB1F75_RS08560 (AB1F75_08560) comGA 1641111..1642181 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  AB1F75_RS08565 (AB1F75_08565) comGB 1642168..1643205 (+) 1038 WP_044052501.1 comG operon protein ComGB Machinery gene
  AB1F75_RS08570 (AB1F75_08570) comGC 1643219..1643515 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  AB1F75_RS08575 (AB1F75_08575) comGD 1643505..1643936 (+) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  AB1F75_RS08580 (AB1F75_08580) comGE 1643920..1644267 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  AB1F75_RS08585 (AB1F75_08585) comGF 1644293..1644676 (+) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  AB1F75_RS08590 (AB1F75_08590) comGG 1644677..1645051 (+) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  AB1F75_RS08595 (AB1F75_08595) spoIITA 1645122..1645302 (+) 181 Protein_1684 YqzE family protein -
  AB1F75_RS08600 (AB1F75_08600) yqzG 1645344..1645670 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  AB1F75_RS08605 (AB1F75_08605) tapA 1645942..1646703 (+) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  AB1F75_RS08610 (AB1F75_08610) sipW 1646687..1647259 (+) 573 WP_003246088.1 signal peptidase I SipW -
  AB1F75_RS08615 (AB1F75_08615) tasA 1647323..1648108 (+) 786 WP_015251717.1 biofilm matrix protein TasA -
  AB1F75_RS08620 (AB1F75_08620) sinR 1648201..1648536 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AB1F75_RS08625 (AB1F75_08625) sinI 1648570..1648743 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14280.43 Da        Isoelectric Point: 6.4838

>NTDB_id=1020807 AB1F75_RS08585 WP_015251713.1 1644293..1644676(+) (comGF) [Bacillus subtilis subsp. subtilis strain BSP1]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1020807 AB1F75_RS08585 WP_015251713.1 1644293..1644676(+) (comGF) [Bacillus subtilis subsp. subtilis strain BSP1]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992


Multiple sequence alignment