Detailed information NTG1020126

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: AB0R86_RS12025
• Genome accession: NZ_CP160227
• Coordinates: 2482180..2482617 (-)
• Length: 145 a.a.
• NCBI ID: WP_012117983.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain JJ947
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2477180..2487617

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AB0R86_RS11975 (AB0R86_11975)	sinI	2477564..2477737 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
AB0R86_RS11980 (AB0R86_11980)	sinR	2477771..2478106 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
AB0R86_RS11985 (AB0R86_11985)	tasA	2478154..2478939 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
AB0R86_RS11990 (AB0R86_11990)	sipW	2479004..2479588 (-)	585	WP_007408328.1	signal peptidase I SipW	-
AB0R86_RS11995 (AB0R86_11995)	tapA	2479560..2480231 (-)	672	WP_020954230.1	amyloid fiber anchoring/assembly protein TapA	-
AB0R86_RS12000 (AB0R86_12000)	-	2480490..2480819 (+)	330	WP_020954231.1	DUF3889 domain-containing protein	-
AB0R86_RS12005 (AB0R86_12005)	-	2480859..2481038 (-)	180	WP_003153093.1	YqzE family protein	-
AB0R86_RS12010 (AB0R86_12010)	comGG	2481095..2481472 (-)	378	WP_007408325.1	competence type IV pilus minor pilin ComGG	Machinery gene
AB0R86_RS12015 (AB0R86_12015)	comGF	2481473..2481973 (-)	501	WP_258566475.1	competence type IV pilus minor pilin ComGF	-
AB0R86_RS12020 (AB0R86_12020)	comGE	2481882..2482196 (-)	315	WP_007408323.1	competence type IV pilus minor pilin ComGE	-
AB0R86_RS12025 (AB0R86_12025)	comGD	2482180..2482617 (-)	438	WP_012117983.1	competence type IV pilus minor pilin ComGD	Machinery gene
AB0R86_RS12030 (AB0R86_12030)	comGC	2482607..2482915 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
AB0R86_RS12035 (AB0R86_12035)	comGB	2482920..2483957 (-)	1038	WP_032866436.1	competence type IV pilus assembly protein ComGB	Machinery gene
AB0R86_RS12040 (AB0R86_12040)	comGA	2483944..2485014 (-)	1071	WP_012117985.1	competence type IV pilus ATPase ComGA	Machinery gene
AB0R86_RS12045 (AB0R86_12045)	-	2485206..2486156 (-)	951	WP_032870601.1	magnesium transporter CorA family protein	-
AB0R86_RS12050 (AB0R86_12050)	-	2486302..2487603 (+)	1302	WP_335395296.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16286.74 Da
• Isoelectric Point: 10.2475

>NTDB_id=1020126 AB0R86_RS12025 WP_012117983.1 2482180..2482617(-) (comGD) [Bacillus velezensis strain JJ947]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1020126 AB0R86_RS12025 WP_012117983.1 2482180..2482617(-) (comGD) [Bacillus velezensis strain JJ947]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATATAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.849	100	0.572