Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AB0R86_RS11975 | Genome accession | NZ_CP160227 |
| Coordinates | 2477564..2477737 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain JJ947 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2472564..2482737
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB0R86_RS11960 (AB0R86_11960) | gcvT | 2473377..2474477 (-) | 1101 | WP_042635355.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AB0R86_RS11965 (AB0R86_11965) | - | 2474901..2476571 (+) | 1671 | WP_007408331.1 | SNF2-related protein | - |
| AB0R86_RS11970 (AB0R86_11970) | - | 2476593..2477387 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| AB0R86_RS11975 (AB0R86_11975) | sinI | 2477564..2477737 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| AB0R86_RS11980 (AB0R86_11980) | sinR | 2477771..2478106 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AB0R86_RS11985 (AB0R86_11985) | tasA | 2478154..2478939 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| AB0R86_RS11990 (AB0R86_11990) | sipW | 2479004..2479588 (-) | 585 | WP_007408328.1 | signal peptidase I SipW | - |
| AB0R86_RS11995 (AB0R86_11995) | tapA | 2479560..2480231 (-) | 672 | WP_020954230.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AB0R86_RS12000 (AB0R86_12000) | - | 2480490..2480819 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| AB0R86_RS12005 (AB0R86_12005) | - | 2480859..2481038 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| AB0R86_RS12010 (AB0R86_12010) | comGG | 2481095..2481472 (-) | 378 | WP_007408325.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AB0R86_RS12015 (AB0R86_12015) | comGF | 2481473..2481973 (-) | 501 | WP_258566475.1 | competence type IV pilus minor pilin ComGF | - |
| AB0R86_RS12020 (AB0R86_12020) | comGE | 2481882..2482196 (-) | 315 | WP_007408323.1 | competence type IV pilus minor pilin ComGE | - |
| AB0R86_RS12025 (AB0R86_12025) | comGD | 2482180..2482617 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1020123 AB0R86_RS11975 WP_003153105.1 2477564..2477737(+) (sinI) [Bacillus velezensis strain JJ947]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1020123 AB0R86_RS11975 WP_003153105.1 2477564..2477737(+) (sinI) [Bacillus velezensis strain JJ947]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |