Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   AB0R86_RS12010 Genome accession   NZ_CP160227
Coordinates   2481095..2481472 (-) Length   125 a.a.
NCBI ID   WP_007408325.1    Uniprot ID   -
Organism   Bacillus velezensis strain JJ947     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2476095..2486472
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R86_RS11970 (AB0R86_11970) - 2476593..2477387 (+) 795 WP_007408330.1 YqhG family protein -
  AB0R86_RS11975 (AB0R86_11975) sinI 2477564..2477737 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  AB0R86_RS11980 (AB0R86_11980) sinR 2477771..2478106 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AB0R86_RS11985 (AB0R86_11985) tasA 2478154..2478939 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  AB0R86_RS11990 (AB0R86_11990) sipW 2479004..2479588 (-) 585 WP_007408328.1 signal peptidase I SipW -
  AB0R86_RS11995 (AB0R86_11995) tapA 2479560..2480231 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  AB0R86_RS12000 (AB0R86_12000) - 2480490..2480819 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  AB0R86_RS12005 (AB0R86_12005) - 2480859..2481038 (-) 180 WP_003153093.1 YqzE family protein -
  AB0R86_RS12010 (AB0R86_12010) comGG 2481095..2481472 (-) 378 WP_007408325.1 competence type IV pilus minor pilin ComGG Machinery gene
  AB0R86_RS12015 (AB0R86_12015) comGF 2481473..2481973 (-) 501 WP_258566475.1 competence type IV pilus minor pilin ComGF -
  AB0R86_RS12020 (AB0R86_12020) comGE 2481882..2482196 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  AB0R86_RS12025 (AB0R86_12025) comGD 2482180..2482617 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  AB0R86_RS12030 (AB0R86_12030) comGC 2482607..2482915 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  AB0R86_RS12035 (AB0R86_12035) comGB 2482920..2483957 (-) 1038 WP_032866436.1 competence type IV pilus assembly protein ComGB Machinery gene
  AB0R86_RS12040 (AB0R86_12040) comGA 2483944..2485014 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  AB0R86_RS12045 (AB0R86_12045) - 2485206..2486156 (-) 951 WP_032870601.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14183.05 Da        Isoelectric Point: 9.7381

>NTDB_id=1020125 AB0R86_RS12010 WP_007408325.1 2481095..2481472(-) (comGG) [Bacillus velezensis strain JJ947]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWTGENLLQNGALLSSRHMTQGQRVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1020125 AB0R86_RS12010 WP_007408325.1 2481095..2481472(-) (comGG) [Bacillus velezensis strain JJ947]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGACCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAGGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGGCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488


Multiple sequence alignment