Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   AB0R65_RS11840 Genome accession   NZ_CP160225
Coordinates   2465161..2465538 (-) Length   125 a.a.
NCBI ID   WP_167340753.1    Uniprot ID   -
Organism   Bacillus velezensis strain JJ1284     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2460161..2470538
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R65_RS11800 (AB0R65_11800) - 2460659..2461453 (+) 795 WP_015240204.1 YqhG family protein -
  AB0R65_RS11805 (AB0R65_11805) sinI 2461630..2461803 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  AB0R65_RS11810 (AB0R65_11810) sinR 2461837..2462172 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AB0R65_RS11815 (AB0R65_11815) tasA 2462220..2463005 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  AB0R65_RS11820 (AB0R65_11820) sipW 2463070..2463654 (-) 585 WP_025284996.1 signal peptidase I SipW -
  AB0R65_RS11825 (AB0R65_11825) tapA 2463626..2464297 (-) 672 WP_015240206.1 amyloid fiber anchoring/assembly protein TapA -
  AB0R65_RS11830 (AB0R65_11830) - 2464556..2464885 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  AB0R65_RS11835 (AB0R65_11835) - 2464925..2465104 (-) 180 WP_003153093.1 YqzE family protein -
  AB0R65_RS11840 (AB0R65_11840) comGG 2465161..2465538 (-) 378 WP_167340753.1 competence type IV pilus minor pilin ComGG Machinery gene
  AB0R65_RS11845 (AB0R65_11845) comGF 2465539..2466039 (-) 501 WP_257720329.1 competence type IV pilus minor pilin ComGF -
  AB0R65_RS11850 (AB0R65_11850) comGE 2465948..2466262 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  AB0R65_RS11855 (AB0R65_11855) comGD 2466246..2466683 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  AB0R65_RS11860 (AB0R65_11860) comGC 2466673..2466981 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  AB0R65_RS11865 (AB0R65_11865) comGB 2466986..2468023 (-) 1038 WP_015240211.1 competence type IV pilus assembly protein ComGB Machinery gene
  AB0R65_RS11870 (AB0R65_11870) comGA 2468010..2469080 (-) 1071 WP_163113647.1 competence type IV pilus ATPase ComGA Machinery gene
  AB0R65_RS11875 (AB0R65_11875) - 2469274..2470224 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14157.10 Da        Isoelectric Point: 9.9599

>NTDB_id=1019988 AB0R65_RS11840 WP_167340753.1 2465161..2465538(-) (comGG) [Bacillus velezensis strain JJ1284]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFFTRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRRGAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1019988 AB0R65_RS11840 WP_167340753.1 2465161..2465538(-) (comGG) [Bacillus velezensis strain JJ1284]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCTTCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACCGGAACGAGACGGGG
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504


Multiple sequence alignment