Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AB0R65_RS11805 | Genome accession | NZ_CP160225 |
| Coordinates | 2461630..2461803 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain JJ1284 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2456630..2466803
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB0R65_RS11790 (AB0R65_11790) | gcvT | 2457443..2458543 (-) | 1101 | WP_025284994.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AB0R65_RS11795 (AB0R65_11795) | - | 2458967..2460637 (+) | 1671 | WP_108655005.1 | SNF2-related protein | - |
| AB0R65_RS11800 (AB0R65_11800) | - | 2460659..2461453 (+) | 795 | WP_015240204.1 | YqhG family protein | - |
| AB0R65_RS11805 (AB0R65_11805) | sinI | 2461630..2461803 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| AB0R65_RS11810 (AB0R65_11810) | sinR | 2461837..2462172 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AB0R65_RS11815 (AB0R65_11815) | tasA | 2462220..2463005 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| AB0R65_RS11820 (AB0R65_11820) | sipW | 2463070..2463654 (-) | 585 | WP_025284996.1 | signal peptidase I SipW | - |
| AB0R65_RS11825 (AB0R65_11825) | tapA | 2463626..2464297 (-) | 672 | WP_015240206.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AB0R65_RS11830 (AB0R65_11830) | - | 2464556..2464885 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| AB0R65_RS11835 (AB0R65_11835) | - | 2464925..2465104 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| AB0R65_RS11840 (AB0R65_11840) | comGG | 2465161..2465538 (-) | 378 | WP_167340753.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AB0R65_RS11845 (AB0R65_11845) | comGF | 2465539..2466039 (-) | 501 | WP_257720329.1 | competence type IV pilus minor pilin ComGF | - |
| AB0R65_RS11850 (AB0R65_11850) | comGE | 2465948..2466262 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| AB0R65_RS11855 (AB0R65_11855) | comGD | 2466246..2466683 (-) | 438 | WP_043020787.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1019986 AB0R65_RS11805 WP_003153105.1 2461630..2461803(+) (sinI) [Bacillus velezensis strain JJ1284]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1019986 AB0R65_RS11805 WP_003153105.1 2461630..2461803(+) (sinI) [Bacillus velezensis strain JJ1284]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |