Detailed information NTG1019989

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: AB0R65_RS11855
• Genome accession: NZ_CP160225
• Coordinates: 2466246..2466683 (-)
• Length: 145 a.a.
• NCBI ID: WP_043020787.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain JJ1284
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2461246..2471683

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AB0R65_RS11805 (AB0R65_11805)	sinI	2461630..2461803 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
AB0R65_RS11810 (AB0R65_11810)	sinR	2461837..2462172 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
AB0R65_RS11815 (AB0R65_11815)	tasA	2462220..2463005 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
AB0R65_RS11820 (AB0R65_11820)	sipW	2463070..2463654 (-)	585	WP_025284996.1	signal peptidase I SipW	-
AB0R65_RS11825 (AB0R65_11825)	tapA	2463626..2464297 (-)	672	WP_015240206.1	amyloid fiber anchoring/assembly protein TapA	-
AB0R65_RS11830 (AB0R65_11830)	-	2464556..2464885 (+)	330	WP_012117979.1	DUF3889 domain-containing protein	-
AB0R65_RS11835 (AB0R65_11835)	-	2464925..2465104 (-)	180	WP_003153093.1	YqzE family protein	-
AB0R65_RS11840 (AB0R65_11840)	comGG	2465161..2465538 (-)	378	WP_167340753.1	competence type IV pilus minor pilin ComGG	Machinery gene
AB0R65_RS11845 (AB0R65_11845)	comGF	2465539..2466039 (-)	501	WP_257720329.1	competence type IV pilus minor pilin ComGF	-
AB0R65_RS11850 (AB0R65_11850)	comGE	2465948..2466262 (-)	315	WP_012117982.1	competence type IV pilus minor pilin ComGE	-
AB0R65_RS11855 (AB0R65_11855)	comGD	2466246..2466683 (-)	438	WP_043020787.1	competence type IV pilus minor pilin ComGD	Machinery gene
AB0R65_RS11860 (AB0R65_11860)	comGC	2466673..2466981 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
AB0R65_RS11865 (AB0R65_11865)	comGB	2466986..2468023 (-)	1038	WP_015240211.1	competence type IV pilus assembly protein ComGB	Machinery gene
AB0R65_RS11870 (AB0R65_11870)	comGA	2468010..2469080 (-)	1071	WP_163113647.1	competence type IV pilus ATPase ComGA	Machinery gene
AB0R65_RS11875 (AB0R65_11875)	-	2469274..2470224 (-)	951	WP_007408319.1	magnesium transporter CorA family protein	-
AB0R65_RS11880 (AB0R65_11880)	-	2470370..2471671 (+)	1302	WP_021494315.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16271.77 Da
• Isoelectric Point: 10.2475

>NTDB_id=1019989 AB0R65_RS11855 WP_043020787.1 2466246..2466683(-) (comGD) [Bacillus velezensis strain JJ1284]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTELLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1019989 AB0R65_RS11855 WP_043020787.1 2466246..2466683(-) (comGD) [Bacillus velezensis strain JJ1284]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACTGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTTCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.164	100	0.566