Detailed information NTG1010761

Bioinformatically predicted

Overview

• Name: comGF
• Type: Machinery gene
• Locus tag: H1W74_RS08450
• Genome accession: NZ_LR822031
• Coordinates: 1641489..1641926 (-)
• Length: 145 a.a.
• NCBI ID: WP_022096897.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus isolate STH_CIRM_1047
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1636489..1646926

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
H1W74_RS08415 (STHERMO_1921)	-	1636548..1637210 (-)	663	WP_002946116.1	CPBP family intramembrane glutamic endopeptidase	-
H1W74_RS08420 (STHERMO_1922)	-	1637313..1637756 (-)	444	WP_002946118.1	hypothetical protein	-
H1W74_RS09935 (STHERMO_1923)	-	1637830..1638255 (-)	426	WP_014608739.1	CPBP family intramembrane glutamic endopeptidase	-
H1W74_RS08430 (STHERMO_1925)	-	1638498..1638695 (-)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
H1W74_RS08435 (STHERMO_1926)	-	1638944..1640137 (-)	1194	WP_022096898.1	acetate kinase	-
H1W74_RS08440 (STHERMO_1927)	comGH	1640193..1641149 (-)	957	WP_011226622.1	class I SAM-dependent methyltransferase	Machinery gene
H1W74_RS08445 (STHERMO_1928)	comGG	1641194..1641511 (-)	318	WP_002952035.1	competence type IV pilus minor pilin ComGG	Machinery gene
H1W74_RS08450 (STHERMO_1929)	comGF	1641489..1641926 (-)	438	WP_022096897.1	competence type IV pilus minor pilin ComGF	Machinery gene
H1W74_RS08455 (STHERMO_1930)	comGE	1641910..1642203 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	Machinery gene
H1W74_RS08460 (STHERMO_1931)	comGD	1642175..1642603 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
H1W74_RS08465 (STHERMO_1932)	comGC	1642563..1642889 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
H1W74_RS08470 (STHERMO_1933)	comGB	1642886..1643986 (-)	1101	WP_116920398.1	competence type IV pilus assembly protein ComGB	Machinery gene
H1W74_RS08475 (STHERMO_1934)	comGA/cglA/cilD	1643868..1644809 (-)	942	WP_022096896.1	competence type IV pilus ATPase ComGA	Machinery gene
H1W74_RS08480 (STHERMO_1935)	-	1644890..1645252 (-)	363	WP_011226630.1	DUF1033 family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16375.89 Da
• Isoelectric Point: 8.9784

>NTDB_id=1010761 H1W74_RS08450 WP_022096897.1 1641489..1641926(-) (comGF) [Streptococcus thermophilus isolate STH_CIRM_1047]
MYLSSKLRAFTLLECLVALLVIAGSVQVYQGLTTVLVSNVKQVRQQENQDWLLFVQQMEAELEGCQLVKVEGNKLYVKKD
NQDLAFGLSSASDFRKTNADGRGYQPMLFDVKSSKVSQKNQIVTIQVTLKNELQRSFVYAFEKTG

Nucleotide

• Length: 438 bp

>NTDB_id=1010761 H1W74_RS08450 WP_022096897.1 1641489..1641926(-) (comGF) [Streptococcus thermophilus isolate STH_CIRM_1047]
ATGTATCTAAGCAGTAAGCTGCGTGCCTTTACCCTCTTGGAATGTCTAGTGGCCTTGTTGGTCATTGCTGGCTCAGTTCA
AGTTTATCAAGGGTTAACCACTGTACTTGTGAGTAATGTTAAGCAGGTAAGACAACAAGAAAACCAAGATTGGCTTCTAT
TTGTTCAACAAATGGAGGCAGAATTAGAAGGATGTCAGTTGGTCAAGGTAGAGGGGAACAAACTCTATGTCAAGAAGGAT
AATCAAGACTTGGCTTTTGGTCTTTCAAGTGCCTCTGATTTTCGAAAAACAAATGCTGATGGTCGAGGTTATCAACCAAT
GCTTTTCGATGTCAAATCTAGTAAGGTAAGTCAAAAGAACCAGATAGTTACCATCCAAGTGACTCTTAAAAATGAACTAC
AAAGGAGTTTTGTTTATGCTTTTGAAAAAACAGGTTAG

Domains

Predicted by InterProScan.

• Putative Competence protein ComGF (ComGF) (39-134)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGF	Streptococcus mutans UA140	58.865	97.241	0.572
comGF	Streptococcus mutans UA159	58.156	97.241	0.566
comGF/cglF	Streptococcus pneumoniae D39	48.571	96.552	0.469
comGF/cglF	Streptococcus pneumoniae Rx1	48.571	96.552	0.469
comGF/cglF	Streptococcus pneumoniae R6	48.571	96.552	0.469
comGF/cglF	Streptococcus pneumoniae TIGR4	48.571	96.552	0.469
comGF/cglF	Streptococcus mitis NCTC 12261	46.809	97.241	0.455
comGF/cglF	Streptococcus mitis SK321	46.099	97.241	0.448
comGF	Lactococcus lactis subsp. cremoris KW2	46.043	95.862	0.441