Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ABFV68_RS11665 Genome accession   NZ_CP156029
Coordinates   2430347..2430724 (-) Length   125 a.a.
NCBI ID   WP_007408325.1    Uniprot ID   -
Organism   Bacillus velezensis strain CH1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2425347..2435724
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABFV68_RS11625 (ABFV68_11625) - 2425845..2426639 (+) 795 WP_007408330.1 YqhG family protein -
  ABFV68_RS11630 (ABFV68_11630) sinI 2426816..2426989 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  ABFV68_RS11635 (ABFV68_11635) sinR 2427023..2427358 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ABFV68_RS11640 (ABFV68_11640) - 2427406..2428191 (-) 786 WP_007408329.1 TasA family protein -
  ABFV68_RS11645 (ABFV68_11645) - 2428256..2428840 (-) 585 WP_007408328.1 signal peptidase I -
  ABFV68_RS11650 (ABFV68_11650) tapA 2428812..2429483 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  ABFV68_RS11655 (ABFV68_11655) - 2429742..2430071 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  ABFV68_RS11660 (ABFV68_11660) - 2430111..2430290 (-) 180 WP_003153093.1 YqzE family protein -
  ABFV68_RS11665 (ABFV68_11665) comGG 2430347..2430724 (-) 378 WP_007408325.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABFV68_RS11670 (ABFV68_11670) comGF 2430725..2431225 (-) 501 WP_257645080.1 competence type IV pilus minor pilin ComGF -
  ABFV68_RS11675 (ABFV68_11675) comGE 2431134..2431448 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  ABFV68_RS11680 (ABFV68_11680) comGD 2431432..2431869 (-) 438 WP_346987922.1 competence type IV pilus minor pilin ComGD Machinery gene
  ABFV68_RS11685 (ABFV68_11685) comGC 2431859..2432167 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ABFV68_RS11690 (ABFV68_11690) comGB 2432172..2433209 (-) 1038 WP_032866436.1 competence type IV pilus assembly protein ComGB Machinery gene
  ABFV68_RS11695 (ABFV68_11695) comGA 2433196..2434266 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  ABFV68_RS11700 (ABFV68_11700) - 2434458..2435408 (-) 951 WP_032870601.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14183.05 Da        Isoelectric Point: 9.7381

>NTDB_id=1001386 ABFV68_RS11665 WP_007408325.1 2430347..2430724(-) (comGG) [Bacillus velezensis strain CH1]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWTGENLLQNGALLSSRHMTQGQRVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1001386 ABFV68_RS11665 WP_007408325.1 2430347..2430724(-) (comGG) [Bacillus velezensis strain CH1]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGACCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAGGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGGCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488

Multiple sequence alignment