Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ABFV68_RS11630 | Genome accession | NZ_CP156029 |
| Coordinates | 2426816..2426989 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain CH1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2421816..2431989
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABFV68_RS11615 (ABFV68_11615) | gcvT | 2422629..2423729 (-) | 1101 | WP_020956076.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ABFV68_RS11620 (ABFV68_11620) | - | 2424153..2425823 (+) | 1671 | WP_007408331.1 | SNF2-related protein | - |
| ABFV68_RS11625 (ABFV68_11625) | - | 2425845..2426639 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| ABFV68_RS11630 (ABFV68_11630) | sinI | 2426816..2426989 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| ABFV68_RS11635 (ABFV68_11635) | sinR | 2427023..2427358 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ABFV68_RS11640 (ABFV68_11640) | - | 2427406..2428191 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| ABFV68_RS11645 (ABFV68_11645) | - | 2428256..2428840 (-) | 585 | WP_007408328.1 | signal peptidase I | - |
| ABFV68_RS11650 (ABFV68_11650) | tapA | 2428812..2429483 (-) | 672 | WP_020954230.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ABFV68_RS11655 (ABFV68_11655) | - | 2429742..2430071 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| ABFV68_RS11660 (ABFV68_11660) | - | 2430111..2430290 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ABFV68_RS11665 (ABFV68_11665) | comGG | 2430347..2430724 (-) | 378 | WP_007408325.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ABFV68_RS11670 (ABFV68_11670) | comGF | 2430725..2431225 (-) | 501 | WP_257645080.1 | competence type IV pilus minor pilin ComGF | - |
| ABFV68_RS11675 (ABFV68_11675) | comGE | 2431134..2431448 (-) | 315 | WP_007408323.1 | competence type IV pilus minor pilin ComGE | - |
| ABFV68_RS11680 (ABFV68_11680) | comGD | 2431432..2431869 (-) | 438 | WP_346987922.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1001384 ABFV68_RS11630 WP_003153105.1 2426816..2426989(+) (sinI) [Bacillus velezensis strain CH1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1001384 ABFV68_RS11630 WP_003153105.1 2426816..2426989(+) (sinI) [Bacillus velezensis strain CH1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |