Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ABFV68_RS11630 Genome accession   NZ_CP156029
Coordinates   2426816..2426989 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain CH1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2421816..2431989
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABFV68_RS11615 (ABFV68_11615) gcvT 2422629..2423729 (-) 1101 WP_020956076.1 glycine cleavage system aminomethyltransferase GcvT -
  ABFV68_RS11620 (ABFV68_11620) - 2424153..2425823 (+) 1671 WP_007408331.1 SNF2-related protein -
  ABFV68_RS11625 (ABFV68_11625) - 2425845..2426639 (+) 795 WP_007408330.1 YqhG family protein -
  ABFV68_RS11630 (ABFV68_11630) sinI 2426816..2426989 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  ABFV68_RS11635 (ABFV68_11635) sinR 2427023..2427358 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ABFV68_RS11640 (ABFV68_11640) - 2427406..2428191 (-) 786 WP_007408329.1 TasA family protein -
  ABFV68_RS11645 (ABFV68_11645) - 2428256..2428840 (-) 585 WP_007408328.1 signal peptidase I -
  ABFV68_RS11650 (ABFV68_11650) tapA 2428812..2429483 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  ABFV68_RS11655 (ABFV68_11655) - 2429742..2430071 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  ABFV68_RS11660 (ABFV68_11660) - 2430111..2430290 (-) 180 WP_003153093.1 YqzE family protein -
  ABFV68_RS11665 (ABFV68_11665) comGG 2430347..2430724 (-) 378 WP_007408325.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABFV68_RS11670 (ABFV68_11670) comGF 2430725..2431225 (-) 501 WP_257645080.1 competence type IV pilus minor pilin ComGF -
  ABFV68_RS11675 (ABFV68_11675) comGE 2431134..2431448 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  ABFV68_RS11680 (ABFV68_11680) comGD 2431432..2431869 (-) 438 WP_346987922.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1001384 ABFV68_RS11630 WP_003153105.1 2426816..2426989(+) (sinI) [Bacillus velezensis strain CH1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1001384 ABFV68_RS11630 WP_003153105.1 2426816..2426989(+) (sinI) [Bacillus velezensis strain CH1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment