Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 605705..606504 | Replicon | chromosome |
Accession | NZ_CP122625 | ||
Organism | Escherichia coli strain ETEC4089 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | QDW64_RS02955 | Protein ID | WP_000347273.1 |
Coordinates | 605705..606169 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | QDW64_RS02960 | Protein ID | WP_001307405.1 |
Coordinates | 606169..606504 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW64_RS02925 (600706) | 600706..601140 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
QDW64_RS02930 (601158) | 601158..602036 | - | 879 | WP_001300474.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
QDW64_RS02935 (602026) | 602026..602805 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
QDW64_RS02940 (602816) | 602816..603289 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QDW64_RS02945 (603312) | 603312..604592 | - | 1281 | WP_000681903.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QDW64_RS02950 (604841) | 604841..605650 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
QDW64_RS02955 (605705) | 605705..606169 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QDW64_RS02960 (606169) | 606169..606504 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QDW64_RS02965 (606653) | 606653..608224 | - | 1572 | WP_001723936.1 | galactarate dehydratase | - |
QDW64_RS02970 (608599) | 608599..609933 | + | 1335 | WP_001723935.1 | galactarate/glucarate/glycerate transporter GarP | - |
QDW64_RS02975 (609949) | 609949..610719 | + | 771 | WP_001723934.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 605705..617376 | 11671 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T277385 WP_000347273.1 NZ_CP122625:c606169-605705 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |