Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4159755..4160554 | Replicon | chromosome |
Accession | NZ_CP116188 | ||
Organism | Escherichia coli strain DETEC-E223 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | PIC88_RS20365 | Protein ID | WP_000347273.1 |
Coordinates | 4160090..4160554 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | PIC88_RS20360 | Protein ID | WP_001307405.1 |
Coordinates | 4159755..4160090 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC88_RS20345 (4155540) | 4155540..4156310 | - | 771 | WP_048218026.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
PIC88_RS20350 (4156326) | 4156326..4157660 | - | 1335 | WP_001723935.1 | galactarate/glucarate/glycerate transporter GarP | - |
PIC88_RS20355 (4158035) | 4158035..4159606 | + | 1572 | WP_001723936.1 | galactarate dehydratase | - |
PIC88_RS20360 (4159755) | 4159755..4160090 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
PIC88_RS20365 (4160090) | 4160090..4160554 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
PIC88_RS20370 (4160609) | 4160609..4161418 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
PIC88_RS20375 (4161667) | 4161667..4162947 | + | 1281 | WP_000681903.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
PIC88_RS20380 (4162970) | 4162970..4163443 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
PIC88_RS20385 (4163454) | 4163454..4164233 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
PIC88_RS20390 (4164223) | 4164223..4165101 | + | 879 | WP_001300474.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
PIC88_RS20395 (4165119) | 4165119..4165553 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 4150608..4160554 | 9946 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T268350 WP_000347273.1 NZ_CP116188:4160090-4160554 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |