Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 612124..612923 | Replicon | chromosome |
Accession | NZ_CP103694 | ||
Organism | Escherichia coli strain ST12468 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | M5T31_RS02975 | Protein ID | WP_000347273.1 |
Coordinates | 612124..612588 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | M5T31_RS02980 | Protein ID | WP_001307405.1 |
Coordinates | 612588..612923 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T31_RS02945 (607125) | 607125..607559 | - | 435 | WP_058905827.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
M5T31_RS02950 (607577) | 607577..608455 | - | 879 | WP_001300474.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
M5T31_RS02955 (608445) | 608445..609224 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
M5T31_RS02960 (609235) | 609235..609708 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
M5T31_RS02965 (609731) | 609731..611011 | - | 1281 | WP_000681903.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
M5T31_RS02970 (611260) | 611260..612069 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
M5T31_RS02975 (612124) | 612124..612588 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
M5T31_RS02980 (612588) | 612588..612923 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
M5T31_RS02985 (613072) | 613072..614643 | - | 1572 | WP_001723936.1 | galactarate dehydratase | - |
M5T31_RS02990 (615018) | 615018..616352 | + | 1335 | WP_001723935.1 | galactarate/glucarate/glycerate transporter GarP | - |
M5T31_RS02995 (616368) | 616368..617138 | + | 771 | WP_001723934.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 612124..623682 | 11558 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T256195 WP_000347273.1 NZ_CP103694:c612588-612124 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |