Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 604926..605725 | Replicon | chromosome |
Accession | NZ_CP097430 | ||
Organism | Escherichia coli strain C288 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | M8Y68_RS02950 | Protein ID | WP_000347273.1 |
Coordinates | 604926..605390 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | M8Y68_RS02955 | Protein ID | WP_001307405.1 |
Coordinates | 605390..605725 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8Y68_RS02920 (599927) | 599927..600361 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
M8Y68_RS02925 (600379) | 600379..601257 | - | 879 | WP_001300474.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
M8Y68_RS02930 (601247) | 601247..602026 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
M8Y68_RS02935 (602037) | 602037..602510 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
M8Y68_RS02940 (602533) | 602533..603813 | - | 1281 | WP_000681903.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
M8Y68_RS02945 (604062) | 604062..604871 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
M8Y68_RS02950 (604926) | 604926..605390 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
M8Y68_RS02955 (605390) | 605390..605725 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
M8Y68_RS02960 (605874) | 605874..607445 | - | 1572 | WP_001723936.1 | galactarate dehydratase | - |
M8Y68_RS02965 (607820) | 607820..609154 | + | 1335 | WP_001723935.1 | galactarate/glucarate/glycerate transporter GarP | - |
M8Y68_RS02970 (609170) | 609170..609940 | + | 771 | WP_001723934.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 604926..616598 | 11672 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T245466 WP_000347273.1 NZ_CP097430:c605390-604926 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |