Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ABEG41_RS12415 Genome accession   NZ_CP155795
Coordinates   2411070..2411444 (-) Length   124 a.a.
NCBI ID   WP_015714252.1    Uniprot ID   -
Organism   Bacillus subtilis strain D137     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2406070..2416444
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABEG41_RS12375 (ABEG41_12375) yqhG 2406402..2407196 (+) 795 WP_015714249.1 YqhG family protein -
  ABEG41_RS12380 (ABEG41_12380) sinI 2407379..2407552 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  ABEG41_RS12385 (ABEG41_12385) sinR 2407586..2407921 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ABEG41_RS12390 (ABEG41_12390) tasA 2408014..2408799 (-) 786 WP_015714250.1 biofilm matrix protein TasA -
  ABEG41_RS12395 (ABEG41_12395) sipW 2408863..2409435 (-) 573 WP_003230181.1 signal peptidase I -
  ABEG41_RS12400 (ABEG41_12400) tapA 2409419..2410180 (-) 762 WP_015714251.1 amyloid fiber anchoring/assembly protein TapA -
  ABEG41_RS12405 (ABEG41_12405) yqzG 2410452..2410778 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ABEG41_RS12410 (ABEG41_12410) spoIIT 2410820..2410999 (-) 180 WP_014480252.1 YqzE family protein -
  ABEG41_RS12415 (ABEG41_12415) comGG 2411070..2411444 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  ABEG41_RS12420 (ABEG41_12420) comGF 2411445..2411828 (-) 384 WP_038429292.1 ComG operon protein ComGF Machinery gene
  ABEG41_RS12425 (ABEG41_12425) comGE 2411854..2412201 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene
  ABEG41_RS12430 (ABEG41_12430) comGD 2412185..2412616 (-) 432 WP_015714255.1 comG operon protein ComGD Machinery gene
  ABEG41_RS12435 (ABEG41_12435) comGC 2412606..2412902 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ABEG41_RS12440 (ABEG41_12440) comGB 2412916..2413953 (-) 1038 WP_015714257.1 comG operon protein ComGB Machinery gene
  ABEG41_RS12445 (ABEG41_12445) comGA 2413940..2415010 (-) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  ABEG41_RS12450 (ABEG41_12450) - 2415222..2415419 (-) 198 WP_014480259.1 CBS domain-containing protein -
  ABEG41_RS12455 (ABEG41_12455) corA 2415421..2416374 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14524.73 Da        Isoelectric Point: 8.7849

>NTDB_id=999394 ABEG41_RS12415 WP_015714252.1 2411070..2411444(-) (comGG) [Bacillus subtilis strain D137]
MYRTRGFIYPAILFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=999394 ABEG41_RS12415 WP_015714252.1 2411070..2411444(-) (comGG) [Bacillus subtilis strain D137]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCAATTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGGACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAGCTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.968

100

0.96


Multiple sequence alignment