Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ABEG41_RS12380 Genome accession   NZ_CP155795
Coordinates   2407379..2407552 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain D137     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2402379..2412552
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABEG41_RS12365 (ABEG41_12365) gcvT 2403178..2404266 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  ABEG41_RS12370 (ABEG41_12370) yqhH 2404708..2406381 (+) 1674 WP_003230203.1 SNF2-related protein -
  ABEG41_RS12375 (ABEG41_12375) yqhG 2406402..2407196 (+) 795 WP_015714249.1 YqhG family protein -
  ABEG41_RS12380 (ABEG41_12380) sinI 2407379..2407552 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  ABEG41_RS12385 (ABEG41_12385) sinR 2407586..2407921 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ABEG41_RS12390 (ABEG41_12390) tasA 2408014..2408799 (-) 786 WP_015714250.1 biofilm matrix protein TasA -
  ABEG41_RS12395 (ABEG41_12395) sipW 2408863..2409435 (-) 573 WP_003230181.1 signal peptidase I -
  ABEG41_RS12400 (ABEG41_12400) tapA 2409419..2410180 (-) 762 WP_015714251.1 amyloid fiber anchoring/assembly protein TapA -
  ABEG41_RS12405 (ABEG41_12405) yqzG 2410452..2410778 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ABEG41_RS12410 (ABEG41_12410) spoIIT 2410820..2410999 (-) 180 WP_014480252.1 YqzE family protein -
  ABEG41_RS12415 (ABEG41_12415) comGG 2411070..2411444 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  ABEG41_RS12420 (ABEG41_12420) comGF 2411445..2411828 (-) 384 WP_038429292.1 ComG operon protein ComGF Machinery gene
  ABEG41_RS12425 (ABEG41_12425) comGE 2411854..2412201 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=999392 ABEG41_RS12380 WP_003230187.1 2407379..2407552(+) (sinI) [Bacillus subtilis strain D137]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=999392 ABEG41_RS12380 WP_003230187.1 2407379..2407552(+) (sinI) [Bacillus subtilis strain D137]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment