Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | ABC804_RS08445 | Genome accession | NZ_CP155536 |
| Coordinates | 1601160..1601309 (-) | Length | 49 a.a. |
| NCBI ID | WP_001808912.1 | Uniprot ID | A0A4J1ZTW6 |
| Organism | Streptococcus pneumoniae strain M264-3 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1596160..1606309
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABC804_RS08410 (ABC804_08405) | trmB | 1596509..1597144 (-) | 636 | WP_001266080.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
| ABC804_RS08415 (ABC804_08410) | ccrZ | 1597141..1597935 (-) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| ABC804_RS08420 (ABC804_08415) | - | 1598096..1598707 (-) | 612 | WP_000394047.1 | type II CAAX endopeptidase family protein | - |
| ABC804_RS08425 (ABC804_08420) | blpZ | 1598737..1598985 (-) | 249 | WP_000276499.1 | immunity protein BlpZ | - |
| ABC804_RS08430 (ABC804_08425) | - | 1599027..1599716 (-) | 690 | WP_000760526.1 | CPBP family intramembrane glutamic endopeptidase | - |
| ABC804_RS08435 (ABC804_08430) | - | 1599768..1600151 (-) | 384 | WP_000877381.1 | hypothetical protein | - |
| ABC804_RS08440 (ABC804_08435) | - | 1600937..1601056 (-) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| ABC804_RS08445 (ABC804_08440) | cipB | 1601160..1601309 (-) | 150 | WP_001808912.1 | bacteriocin-like peptide BlpO | Regulator |
| ABC804_RS08450 (ABC804_08445) | blpI | 1601776..1601973 (-) | 198 | WP_001093258.1 | bacteriocin-like peptide BlpI | - |
| ABC804_RS08455 (ABC804_08450) | comA/nlmT | 1602255..1602842 (+) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| ABC804_RS08460 (ABC804_08455) | comA/nlmT | 1602787..1603512 (+) | 726 | WP_167750760.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| ABC804_RS08465 (ABC804_08460) | comA/nlmT | 1603502..1603942 (+) | 441 | WP_001808911.1 | ATP-binding cassette domain-containing protein | Regulator |
| ABC804_RS08470 (ABC804_08465) | comA/nlmT | 1603926..1604414 (+) | 489 | WP_307774349.1 | ATP-binding cassette domain-containing protein | Regulator |
| ABC804_RS08475 (ABC804_08470) | - | 1604425..1605786 (+) | 1362 | WP_001069092.1 | bacteriocin secretion accessory protein | - |
| ABC804_RS08480 (ABC804_08475) | blpC | 1605843..1605998 (+) | 156 | WP_000358813.1 | quorum-sensing system pheromone BlpC | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5150.86 Da Isoelectric Point: 3.7098
>NTDB_id=997444 ABC804_RS08445 WP_001808912.1 1601160..1601309(-) (cipB) [Streptococcus pneumoniae strain M264-3]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=997444 ABC804_RS08445 WP_001808912.1 1601160..1601309(-) (cipB) [Streptococcus pneumoniae strain M264-3]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |