Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   AAH687_RS04530 Genome accession   NZ_CP155530
Coordinates   912307..912849 (+) Length   180 a.a.
NCBI ID   WP_007497456.1    Uniprot ID   A0A5K1N7D0
Organism   Bacillus altitudinis strain TN5S8     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 864514..914295 912307..912849 within 0


Gene organization within MGE regions


Location: 864514..914295
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAH687_RS04300 (AAH687_04300) dnaX 864514..866226 (-) 1713 WP_346395414.1 DNA polymerase III subunit gamma/tau -
  AAH687_RS04310 (AAH687_04310) tadA 866898..867374 (-) 477 WP_008342015.1 tRNA adenosine(34) deaminase TadA -
  AAH687_RS04315 (AAH687_04315) - 867454..868008 (+) 555 WP_008342017.1 isochorismatase family cysteine hydrolase -
  AAH687_RS04320 (AAH687_04320) - 868054..869355 (+) 1302 WP_008342019.1 glycoside hydrolase family 18 protein -
  AAH687_RS04325 (AAH687_04325) - 869435..870058 (+) 624 WP_008342021.1 deoxynucleoside kinase -
  AAH687_RS04330 (AAH687_04330) - 870055..870714 (+) 660 WP_008342023.1 deoxynucleoside kinase -
  AAH687_RS04340 (AAH687_04340) - 871183..872010 (-) 828 WP_008342025.1 methyl-accepting chemotaxis protein -
  AAH687_RS04345 (AAH687_04345) serS 872112..873386 (-) 1275 WP_008342028.1 serine--tRNA ligase -
  AAH687_RS04350 (AAH687_04350) pdxT 873704..874294 (-) 591 WP_008342030.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
  AAH687_RS04355 (AAH687_04355) pdxS 874315..875199 (-) 885 WP_008342033.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
  AAH687_RS04360 (AAH687_04360) - 875446..876924 (+) 1479 WP_346395420.1 PLP-dependent aminotransferase family protein -
  AAH687_RS04365 (AAH687_04365) - 876967..878292 (-) 1326 WP_008342036.1 D-alanyl-D-alanine carboxypeptidase family protein -
  AAH687_RS04370 (AAH687_04370) guaB 878453..879919 (-) 1467 WP_008342039.1 IMP dehydrogenase -
  AAH687_RS04375 (AAH687_04375) - 880041..881009 (+) 969 WP_072368517.1 YaaC family protein -
  AAH687_RS04405 (AAH687_04405) gyrA 886402..888906 (-) 2505 WP_346395423.1 DNA gyrase subunit A -
  AAH687_RS04410 (AAH687_04410) gyrB 889140..891056 (-) 1917 WP_025206585.1 DNA topoisomerase (ATP-hydrolyzing) subunit B -
  AAH687_RS04415 (AAH687_04415) - 891114..891359 (-) 246 WP_008360920.1 extracellular matrix/biofilm biosynthesis regulator RemA family protein -
  AAH687_RS04420 (AAH687_04420) recF 891377..892489 (-) 1113 WP_007497487.1 DNA replication/repair protein RecF Machinery gene
  AAH687_RS04425 (AAH687_04425) yaaA 892506..892721 (-) 216 WP_008347598.1 S4 domain-containing protein YaaA -
  AAH687_RS04430 (AAH687_04430) dnaN 892872..894008 (-) 1137 WP_008347596.1 DNA polymerase III subunit beta -
  AAH687_RS04435 (AAH687_04435) dnaA 894205..895545 (-) 1341 WP_008347594.1 chromosomal replication initiator protein DnaA -
  AAH687_RS04440 (AAH687_04440) rpmH 896166..896300 (+) 135 WP_008360908.1 50S ribosomal protein L34 -
  AAH687_RS04445 (AAH687_04445) rnpA 896379..896738 (+) 360 WP_008347592.1 ribonuclease P protein component -
  AAH687_RS04450 (AAH687_04450) spoIIIJ 896897..897679 (+) 783 WP_139336409.1 YidC family membrane integrase SpoIIIJ -
  AAH687_RS04455 (AAH687_04455) jag 897676..898299 (+) 624 WP_076821512.1 RNA-binding cell elongation regulator Jag/EloR -
  AAH687_RS04460 (AAH687_04460) mnmE 898702..900081 (+) 1380 WP_076821510.1 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE -
  AAH687_RS04465 (AAH687_04465) mnmG 900099..901985 (+) 1887 WP_050826819.1 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG -
  AAH687_RS04470 (AAH687_04470) rsmG 901999..902718 (+) 720 WP_007497477.1 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG -
  AAH687_RS04475 (AAH687_04475) noc 902824..903699 (+) 876 WP_008347579.1 nucleoid occlusion protein -
  AAH687_RS04480 (AAH687_04480) - 903828..904661 (+) 834 WP_048001990.1 YiiX/YebB-like N1pC/P60 family cysteine hydrolase -
  AAH687_RS04485 (AAH687_04485) soj 904898..905659 (+) 762 WP_008360890.1 sporulation initiation inhibitor protein Soj -
  AAH687_RS04490 (AAH687_04490) - 905652..906506 (+) 855 WP_008347572.1 ParB/RepB/Spo0J family partition protein -
  AAH687_RS04495 (AAH687_04495) yyaC 906532..907158 (-) 627 WP_008347570.1 spore protease YyaC -
  AAH687_RS04500 (AAH687_04500) - 907231..908286 (+) 1056 WP_079919768.1 hypothetical protein -
  AAH687_RS04505 (AAH687_04505) - 908312..908722 (-) 411 WP_008347564.1 hypothetical protein -
  AAH687_RS04510 (AAH687_04510) - 908738..910057 (-) 1320 WP_212357642.1 hydrolase -
  AAH687_RS04515 (AAH687_04515) - 910352..910558 (+) 207 WP_008347561.1 DUF951 domain-containing protein -
  AAH687_RS04520 (AAH687_04520) ychF 910774..911874 (+) 1101 WP_007497458.1 redox-regulated ATPase YchF -
  AAH687_RS04525 (AAH687_04525) rpsF 911983..912270 (+) 288 WP_008347557.1 30S ribosomal protein S6 -
  AAH687_RS04530 (AAH687_04530) ssbA 912307..912849 (+) 543 WP_007497456.1 single-stranded DNA-binding protein SsbA Machinery gene
  AAH687_RS04535 (AAH687_04535) rpsR 912891..913130 (+) 240 WP_008347556.1 30S ribosomal protein S18 -
  AAH687_RS04540 (AAH687_04540) - 913330..914295 (+) 966 WP_008347553.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 180 a.a.        Molecular weight: 19605.15 Da        Isoelectric Point: 4.6109

>NTDB_id=996936 AAH687_RS04530 WP_007497456.1 912307..912849(+) (ssbA) [Bacillus altitudinis strain TN5S8]
MLNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAENVANFLKKGSLAGVDGRLQTR
NYENQQGQRVFVTEVQAESVQFLEPKSGGAGSGGYSGGGNSGGQYYGGSQNDQNPFGNEPSQNPYGNQNNQNRNQGNSFN
DDPFANDGKPIDISDDDLPF

Nucleotide


Download         Length: 543 bp        

>NTDB_id=996936 AAH687_RS04530 WP_007497456.1 912307..912849(+) (ssbA) [Bacillus altitudinis strain TN5S8]
ATGCTAAACCGTGTTGTATTGGTCGGAAGACTAACAAAAGACCCTGAGCTTCGCTACACGCCTAATGGTGCGGCTGTAGC
CACGTTTACTCTAGCTGTGAATCGTACGTTTACGAATCAATCTGGAGAGCGTGAAGCCGATTTCATTAACTGTGTTACTT
GGAGAAGACAAGCCGAGAACGTGGCTAATTTCTTGAAAAAAGGAAGTCTTGCCGGTGTAGACGGTCGCTTGCAGACAAGA
AACTATGAAAACCAGCAAGGACAACGTGTCTTCGTGACAGAAGTTCAAGCTGAAAGTGTTCAATTTCTTGAGCCTAAAAG
CGGCGGTGCTGGTTCAGGTGGATACAGCGGCGGTGGTAATAGCGGAGGCCAGTATTATGGCGGCAGCCAAAATGATCAGA
ATCCATTTGGAAATGAACCAAGTCAAAATCCATATGGCAATCAAAACAACCAAAATCGTAATCAGGGAAATAGCTTCAAT
GATGACCCATTTGCGAATGATGGTAAACCGATTGACATCTCCGATGATGATTTGCCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A5K1N7D0

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

85.556

100

0.856

  ssb Latilactobacillus sakei subsp. sakei 23K

55.376

100

0.572

  ssbB Bacillus subtilis subsp. subtilis str. 168

64.151

58.889

0.378

  ssb Glaesserella parasuis strain SC1401

35.714

100

0.361


Multiple sequence alignment