Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   AAVB50_RS10230 Genome accession   NZ_CP154923
Coordinates   1885294..1885668 (+) Length   124 a.a.
NCBI ID   WP_345806078.1    Uniprot ID   -
Organism   Bacillus subtilis strain FUA2233     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1880294..1890668
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAVB50_RS10190 (AAVB50_10185) corA 1880364..1881317 (+) 954 WP_015483432.1 magnesium transporter CorA -
  AAVB50_RS10195 (AAVB50_10190) - 1881319..1881516 (+) 198 WP_129134319.1 hypothetical protein -
  AAVB50_RS10200 (AAVB50_10195) comGA 1881728..1882798 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  AAVB50_RS10205 (AAVB50_10200) comGB 1882785..1883822 (+) 1038 WP_345806075.1 comG operon protein ComGB Machinery gene
  AAVB50_RS10210 (AAVB50_10205) comGC 1883836..1884132 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  AAVB50_RS10215 (AAVB50_10210) comGD 1884122..1884553 (+) 432 WP_024573390.1 comG operon protein ComGD Machinery gene
  AAVB50_RS10220 (AAVB50_10215) comGE 1884537..1884884 (+) 348 WP_345806076.1 ComG operon protein 5 Machinery gene
  AAVB50_RS10225 (AAVB50_10220) comGF 1884910..1885293 (+) 384 WP_345806077.1 ComG operon protein ComGF Machinery gene
  AAVB50_RS10230 (AAVB50_10225) comGG 1885294..1885668 (+) 375 WP_345806078.1 ComG operon protein ComGG Machinery gene
  AAVB50_RS10235 (AAVB50_10230) spoIIT 1885739..1885918 (+) 180 WP_003230176.1 YqzE family protein -
  AAVB50_RS10240 (AAVB50_10235) yqzG 1885960..1886286 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  AAVB50_RS10245 (AAVB50_10240) tapA 1886558..1887319 (+) 762 WP_345806079.1 amyloid fiber anchoring/assembly protein TapA -
  AAVB50_RS10250 (AAVB50_10245) sipW 1887303..1887875 (+) 573 WP_072692741.1 signal peptidase I -
  AAVB50_RS10255 (AAVB50_10250) tasA 1887939..1888724 (+) 786 WP_345806080.1 biofilm matrix protein TasA -
  AAVB50_RS10260 (AAVB50_10255) sinR 1888817..1889152 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AAVB50_RS10265 (AAVB50_10260) sinI 1889186..1889359 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  AAVB50_RS10270 (AAVB50_10265) yqhG 1889542..1890336 (-) 795 WP_003230200.1 YqhG family protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14524.69 Da        Isoelectric Point: 9.2806

>NTDB_id=995537 AAVB50_RS10230 WP_345806078.1 1885294..1885668(+) (comGG) [Bacillus subtilis strain FUA2233]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVQEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=995537 AAVB50_RS10230 WP_345806078.1 1885294..1885668(+) (comGG) [Bacillus subtilis strain FUA2233]
ATGTACCGTACGAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATCGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCTATTCGGCATGTTCAAGAGGAACGGAAAGGCCAGGAGGGGACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
GGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGTTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

96.774

100

0.968

Multiple sequence alignment