Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AAVB50_RS10265 Genome accession   NZ_CP154923
Coordinates   1889186..1889359 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain FUA2233     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1884186..1894359
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAVB50_RS10220 (AAVB50_10215) comGE 1884537..1884884 (+) 348 WP_345806076.1 ComG operon protein 5 Machinery gene
  AAVB50_RS10225 (AAVB50_10220) comGF 1884910..1885293 (+) 384 WP_345806077.1 ComG operon protein ComGF Machinery gene
  AAVB50_RS10230 (AAVB50_10225) comGG 1885294..1885668 (+) 375 WP_345806078.1 ComG operon protein ComGG Machinery gene
  AAVB50_RS10235 (AAVB50_10230) spoIIT 1885739..1885918 (+) 180 WP_003230176.1 YqzE family protein -
  AAVB50_RS10240 (AAVB50_10235) yqzG 1885960..1886286 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  AAVB50_RS10245 (AAVB50_10240) tapA 1886558..1887319 (+) 762 WP_345806079.1 amyloid fiber anchoring/assembly protein TapA -
  AAVB50_RS10250 (AAVB50_10245) sipW 1887303..1887875 (+) 573 WP_072692741.1 signal peptidase I -
  AAVB50_RS10255 (AAVB50_10250) tasA 1887939..1888724 (+) 786 WP_345806080.1 biofilm matrix protein TasA -
  AAVB50_RS10260 (AAVB50_10255) sinR 1888817..1889152 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AAVB50_RS10265 (AAVB50_10260) sinI 1889186..1889359 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  AAVB50_RS10270 (AAVB50_10265) yqhG 1889542..1890336 (-) 795 WP_003230200.1 YqhG family protein -
  AAVB50_RS10275 (AAVB50_10270) yqhH 1890357..1892030 (-) 1674 WP_003230203.1 SNF2-related protein -
  AAVB50_RS10280 (AAVB50_10275) gcvT 1892472..1893560 (+) 1089 WP_345806081.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=995539 AAVB50_RS10265 WP_003230187.1 1889186..1889359(-) (sinI) [Bacillus subtilis strain FUA2233]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=995539 AAVB50_RS10265 WP_003230187.1 1889186..1889359(-) (sinI) [Bacillus subtilis strain FUA2233]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment