Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AAVB98_RS17305 | Genome accession | NZ_CP154895 |
| Coordinates | 3287423..3287596 (-) | Length | 57 a.a. |
| NCBI ID | WP_013352860.1 | Uniprot ID | A0A9P1JIA1 |
| Organism | Bacillus amyloliquefaciens strain Fad 77 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3282423..3292596
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAVB98_RS17255 (AAVB98_17255) | comGD | 3282545..3282982 (+) | 438 | WP_013352869.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| AAVB98_RS17260 (AAVB98_17260) | comGE | 3282966..3283280 (+) | 315 | WP_014470662.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| AAVB98_RS17265 (AAVB98_17265) | comGF | 3283189..3283689 (+) | 501 | WP_013352868.1 | competence type IV pilus minor pilin ComGF | - |
| AAVB98_RS17270 (AAVB98_17270) | comGG | 3283691..3284068 (+) | 378 | WP_013352867.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AAVB98_RS17275 (AAVB98_17275) | - | 3284122..3284301 (+) | 180 | WP_013352866.1 | YqzE family protein | - |
| AAVB98_RS17280 (AAVB98_17280) | - | 3284342..3284671 (-) | 330 | WP_013352865.1 | DUF3889 domain-containing protein | - |
| AAVB98_RS17285 (AAVB98_17285) | tapA | 3284929..3285600 (+) | 672 | WP_013352864.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AAVB98_RS17290 (AAVB98_17290) | - | 3285572..3286156 (+) | 585 | WP_013352863.1 | signal peptidase I | - |
| AAVB98_RS17295 (AAVB98_17295) | - | 3286221..3287006 (+) | 786 | WP_013352862.1 | TasA family protein | - |
| AAVB98_RS17300 (AAVB98_17300) | sinR | 3287054..3287389 (-) | 336 | WP_014470659.1 | transcriptional regulator SinR | Regulator |
| AAVB98_RS17305 (AAVB98_17305) | sinI | 3287423..3287596 (-) | 174 | WP_013352860.1 | anti-repressor SinI family protein | Regulator |
| AAVB98_RS17310 (AAVB98_17310) | - | 3287776..3288570 (-) | 795 | WP_013352859.1 | YqhG family protein | - |
| AAVB98_RS17315 (AAVB98_17315) | - | 3288591..3290261 (-) | 1671 | WP_014470658.1 | SNF2-related protein | - |
| AAVB98_RS17320 (AAVB98_17320) | gcvT | 3290685..3291785 (+) | 1101 | WP_013352857.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6689.61 Da Isoelectric Point: 9.8173
>NTDB_id=994811 AAVB98_RS17305 WP_013352860.1 3287423..3287596(-) (sinI) [Bacillus amyloliquefaciens strain Fad 77]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=994811 AAVB98_RS17305 WP_013352860.1 3287423..3287596(-) (sinI) [Bacillus amyloliquefaciens strain Fad 77]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
68.421 |
100 |
0.684 |