Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AAVB98_RS17305 Genome accession   NZ_CP154895
Coordinates   3287423..3287596 (-) Length   57 a.a.
NCBI ID   WP_013352860.1    Uniprot ID   A0A9P1JIA1
Organism   Bacillus amyloliquefaciens strain Fad 77     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3282423..3292596
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAVB98_RS17255 (AAVB98_17255) comGD 3282545..3282982 (+) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene
  AAVB98_RS17260 (AAVB98_17260) comGE 3282966..3283280 (+) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  AAVB98_RS17265 (AAVB98_17265) comGF 3283189..3283689 (+) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  AAVB98_RS17270 (AAVB98_17270) comGG 3283691..3284068 (+) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  AAVB98_RS17275 (AAVB98_17275) - 3284122..3284301 (+) 180 WP_013352866.1 YqzE family protein -
  AAVB98_RS17280 (AAVB98_17280) - 3284342..3284671 (-) 330 WP_013352865.1 DUF3889 domain-containing protein -
  AAVB98_RS17285 (AAVB98_17285) tapA 3284929..3285600 (+) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  AAVB98_RS17290 (AAVB98_17290) - 3285572..3286156 (+) 585 WP_013352863.1 signal peptidase I -
  AAVB98_RS17295 (AAVB98_17295) - 3286221..3287006 (+) 786 WP_013352862.1 TasA family protein -
  AAVB98_RS17300 (AAVB98_17300) sinR 3287054..3287389 (-) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  AAVB98_RS17305 (AAVB98_17305) sinI 3287423..3287596 (-) 174 WP_013352860.1 anti-repressor SinI family protein Regulator
  AAVB98_RS17310 (AAVB98_17310) - 3287776..3288570 (-) 795 WP_013352859.1 YqhG family protein -
  AAVB98_RS17315 (AAVB98_17315) - 3288591..3290261 (-) 1671 WP_014470658.1 SNF2-related protein -
  AAVB98_RS17320 (AAVB98_17320) gcvT 3290685..3291785 (+) 1101 WP_013352857.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6689.61 Da        Isoelectric Point: 9.8173

>NTDB_id=994811 AAVB98_RS17305 WP_013352860.1 3287423..3287596(-) (sinI) [Bacillus amyloliquefaciens strain Fad 77]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=994811 AAVB98_RS17305 WP_013352860.1 3287423..3287596(-) (sinI) [Bacillus amyloliquefaciens strain Fad 77]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684


Multiple sequence alignment