Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   AAVB98_RS17260 Genome accession   NZ_CP154895
Coordinates   3282966..3283280 (+) Length   104 a.a.
NCBI ID   WP_014470662.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain Fad 77     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3277966..3288280
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAVB98_RS17235 (AAVB98_17235) - 3279004..3279954 (+) 951 WP_013352873.1 magnesium transporter CorA family protein -
  AAVB98_RS17240 (AAVB98_17240) comGA 3280148..3281218 (+) 1071 WP_013352872.1 competence type IV pilus ATPase ComGA Machinery gene
  AAVB98_RS17245 (AAVB98_17245) comGB 3281205..3282242 (+) 1038 WP_013352871.1 competence type IV pilus assembly protein ComGB Machinery gene
  AAVB98_RS17250 (AAVB98_17250) comGC 3282247..3282555 (+) 309 WP_013352870.1 competence type IV pilus major pilin ComGC Machinery gene
  AAVB98_RS17255 (AAVB98_17255) comGD 3282545..3282982 (+) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene
  AAVB98_RS17260 (AAVB98_17260) comGE 3282966..3283280 (+) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  AAVB98_RS17265 (AAVB98_17265) comGF 3283189..3283689 (+) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  AAVB98_RS17270 (AAVB98_17270) comGG 3283691..3284068 (+) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  AAVB98_RS17275 (AAVB98_17275) - 3284122..3284301 (+) 180 WP_013352866.1 YqzE family protein -
  AAVB98_RS17280 (AAVB98_17280) - 3284342..3284671 (-) 330 WP_013352865.1 DUF3889 domain-containing protein -
  AAVB98_RS17285 (AAVB98_17285) tapA 3284929..3285600 (+) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  AAVB98_RS17290 (AAVB98_17290) - 3285572..3286156 (+) 585 WP_013352863.1 signal peptidase I -
  AAVB98_RS17295 (AAVB98_17295) - 3286221..3287006 (+) 786 WP_013352862.1 TasA family protein -
  AAVB98_RS17300 (AAVB98_17300) sinR 3287054..3287389 (-) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  AAVB98_RS17305 (AAVB98_17305) sinI 3287423..3287596 (-) 174 WP_013352860.1 anti-repressor SinI family protein Regulator

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11934.89 Da        Isoelectric Point: 6.2120

>NTDB_id=994808 AAVB98_RS17260 WP_014470662.1 3282966..3283280(+) (comGE) [Bacillus amyloliquefaciens strain Fad 77]
MQNGNKGFSTIETLSAMAIWLFLMISIVPVWTGMLTDNLKIEEHQEVYQLLHKHISAYMMSGKKQPSPDVTWKEDGDYYK
VCAAVRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=994808 AAVB98_RS17260 WP_014470662.1 3282966..3283280(+) (comGE) [Bacillus amyloliquefaciens strain Fad 77]
ATGCAGAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCTATTTGGCTGTTCCTTATGATTTCTAT
CGTTCCGGTCTGGACGGGCATGCTGACAGACAATCTGAAAATAGAAGAACACCAGGAAGTGTACCAGCTTCTTCATAAAC
ATATCAGCGCATATATGATGTCCGGAAAAAAGCAGCCATCTCCCGATGTGACGTGGAAGGAGGATGGTGATTATTACAAA
GTCTGTGCAGCTGTCCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment