Detailed information NTG0994807

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: AAVB98_RS17255
• Genome accession: NZ_CP154895
• Coordinates: 3282545..3282982 (+)
• Length: 145 a.a.
• NCBI ID: WP_013352869.1
• Uniprot ID: A0A9P1JIH3
• Organism: Bacillus amyloliquefaciens strain Fad 77
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 3277545..3287982

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AAVB98_RS17230 (AAVB98_17230)	-	3277556..3278857 (-)	1302	WP_013352874.1	hemolysin family protein	-
AAVB98_RS17235 (AAVB98_17235)	-	3279004..3279954 (+)	951	WP_013352873.1	magnesium transporter CorA family protein	-
AAVB98_RS17240 (AAVB98_17240)	comGA	3280148..3281218 (+)	1071	WP_013352872.1	competence type IV pilus ATPase ComGA	Machinery gene
AAVB98_RS17245 (AAVB98_17245)	comGB	3281205..3282242 (+)	1038	WP_013352871.1	competence type IV pilus assembly protein ComGB	Machinery gene
AAVB98_RS17250 (AAVB98_17250)	comGC	3282247..3282555 (+)	309	WP_013352870.1	competence type IV pilus major pilin ComGC	Machinery gene
AAVB98_RS17255 (AAVB98_17255)	comGD	3282545..3282982 (+)	438	WP_013352869.1	competence type IV pilus minor pilin ComGD	Machinery gene
AAVB98_RS17260 (AAVB98_17260)	comGE	3282966..3283280 (+)	315	WP_014470662.1	competence type IV pilus minor pilin ComGE	Machinery gene
AAVB98_RS17265 (AAVB98_17265)	comGF	3283189..3283689 (+)	501	WP_013352868.1	competence type IV pilus minor pilin ComGF	-
AAVB98_RS17270 (AAVB98_17270)	comGG	3283691..3284068 (+)	378	WP_013352867.1	competence type IV pilus minor pilin ComGG	Machinery gene
AAVB98_RS17275 (AAVB98_17275)	-	3284122..3284301 (+)	180	WP_013352866.1	YqzE family protein	-
AAVB98_RS17280 (AAVB98_17280)	-	3284342..3284671 (-)	330	WP_013352865.1	DUF3889 domain-containing protein	-
AAVB98_RS17285 (AAVB98_17285)	tapA	3284929..3285600 (+)	672	WP_013352864.1	amyloid fiber anchoring/assembly protein TapA	-
AAVB98_RS17290 (AAVB98_17290)	-	3285572..3286156 (+)	585	WP_013352863.1	signal peptidase I	-
AAVB98_RS17295 (AAVB98_17295)	-	3286221..3287006 (+)	786	WP_013352862.1	TasA family protein	-
AAVB98_RS17300 (AAVB98_17300)	sinR	3287054..3287389 (-)	336	WP_014470659.1	transcriptional regulator SinR	Regulator
AAVB98_RS17305 (AAVB98_17305)	sinI	3287423..3287596 (-)	174	WP_013352860.1	anti-repressor SinI family protein	Regulator

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16256.71 Da
• Isoelectric Point: 9.7141

>NTDB_id=994807 AAVB98_RS17255 WP_013352869.1 3282545..3282982(+) (comGD) [Bacillus amyloliquefaciens strain Fad 77]
MNNNRLTENGFTLLESLVVLSLASVLLTVLFTAVPPVYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSAGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITIYLGSGNVHAERK

Nucleotide

• Length: 438 bp

>NTDB_id=994807 AAVB98_RS17255 WP_013352869.1 3282545..3282982(+) (comGD) [Bacillus amyloliquefaciens strain Fad 77]
TTGAACAATAACCGGCTGACAGAAAACGGATTCACTCTTCTTGAAAGCCTGGTTGTGTTAAGTCTGGCGTCTGTATTGCT
GACTGTTTTGTTCACGGCGGTTCCGCCGGTTTATACCCATCTGGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGACA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACATTTCTCCCAAAAGAGCATAAATACAAG
CTGCAGTCAGCCGGAAGGATTGTTGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCCGGCGGAAAGATTCAATTGAAAAGCGCGGGATTCACTTATGAAATAACAATTT
ACTTAGGGAGCGGAAATGTCCATGCAGAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.115	95.862	0.538