Detailed information NTG0994697

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: AAVD18_RS08305
• Genome accession: NZ_CP154893
• Coordinates: 1585098..1585535 (-)
• Length: 145 a.a.
• NCBI ID: WP_013352869.1
• Uniprot ID: A0A9P1JIH3
• Organism: Bacillus amyloliquefaciens strain Fad 11/2
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1580098..1590535

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AAVD18_RS08255 (AAVD18_08255)	sinI	1580484..1580657 (+)	174	WP_013352860.1	anti-repressor SinI family protein	Regulator
AAVD18_RS08260 (AAVD18_08260)	sinR	1580691..1581026 (+)	336	WP_014470659.1	transcriptional regulator SinR	Regulator
AAVD18_RS08265 (AAVD18_08265)	-	1581074..1581859 (-)	786	WP_013352862.1	TasA family protein	-
AAVD18_RS08270 (AAVD18_08270)	-	1581924..1582508 (-)	585	WP_013352863.1	signal peptidase I	-
AAVD18_RS08275 (AAVD18_08275)	tapA	1582480..1583151 (-)	672	WP_013352864.1	amyloid fiber anchoring/assembly protein TapA	-
AAVD18_RS08280 (AAVD18_08280)	-	1583409..1583738 (+)	330	WP_013352865.1	DUF3889 domain-containing protein	-
AAVD18_RS08285 (AAVD18_08285)	-	1583779..1583958 (-)	180	WP_013352866.1	YqzE family protein	-
AAVD18_RS08290 (AAVD18_08290)	comGG	1584012..1584389 (-)	378	WP_013352867.1	competence type IV pilus minor pilin ComGG	Machinery gene
AAVD18_RS08295 (AAVD18_08295)	comGF	1584391..1584891 (-)	501	WP_013352868.1	competence type IV pilus minor pilin ComGF	-
AAVD18_RS08300 (AAVD18_08300)	comGE	1584800..1585114 (-)	315	WP_014470662.1	competence type IV pilus minor pilin ComGE	Machinery gene
AAVD18_RS08305 (AAVD18_08305)	comGD	1585098..1585535 (-)	438	WP_013352869.1	competence type IV pilus minor pilin ComGD	Machinery gene
AAVD18_RS08310 (AAVD18_08310)	comGC	1585525..1585833 (-)	309	WP_013352870.1	competence type IV pilus major pilin ComGC	Machinery gene
AAVD18_RS08315 (AAVD18_08315)	comGB	1585838..1586875 (-)	1038	WP_013352871.1	competence type IV pilus assembly protein ComGB	Machinery gene
AAVD18_RS08320 (AAVD18_08320)	comGA	1586862..1587932 (-)	1071	WP_013352872.1	competence type IV pilus ATPase ComGA	Machinery gene
AAVD18_RS08325 (AAVD18_08325)	-	1588126..1589076 (-)	951	WP_013352873.1	magnesium transporter CorA family protein	-
AAVD18_RS08330 (AAVD18_08330)	-	1589223..1590524 (+)	1302	WP_013352874.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16256.71 Da
• Isoelectric Point: 9.7141

>NTDB_id=994697 AAVD18_RS08305 WP_013352869.1 1585098..1585535(-) (comGD) [Bacillus amyloliquefaciens strain Fad 11/2]
MNNNRLTENGFTLLESLVVLSLASVLLTVLFTAVPPVYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSAGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITIYLGSGNVHAERK

Nucleotide

• Length: 438 bp

>NTDB_id=994697 AAVD18_RS08305 WP_013352869.1 1585098..1585535(-) (comGD) [Bacillus amyloliquefaciens strain Fad 11/2]
TTGAACAATAACCGGCTGACAGAAAACGGATTCACTCTTCTTGAAAGCCTGGTTGTGTTAAGTCTGGCGTCTGTATTGCT
GACTGTTTTGTTCACGGCGGTTCCGCCGGTTTATACCCATCTGGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGACA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACATTTCTCCCAAAAGAGCATAAATACAAG
CTGCAGTCAGCCGGAAGGATTGTTGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCCGGCGGAAAGATTCAATTGAAAAGCGCGGGATTCACTTATGAAATAACAATTT
ACTTAGGGAGCGGAAATGTCCATGCAGAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.115	95.862	0.538