Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   AAVD18_RS08300 Genome accession   NZ_CP154893
Coordinates   1584800..1585114 (-) Length   104 a.a.
NCBI ID   WP_014470662.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain Fad 11/2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1579800..1590114
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAVD18_RS08255 (AAVD18_08255) sinI 1580484..1580657 (+) 174 WP_013352860.1 anti-repressor SinI family protein Regulator
  AAVD18_RS08260 (AAVD18_08260) sinR 1580691..1581026 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  AAVD18_RS08265 (AAVD18_08265) - 1581074..1581859 (-) 786 WP_013352862.1 TasA family protein -
  AAVD18_RS08270 (AAVD18_08270) - 1581924..1582508 (-) 585 WP_013352863.1 signal peptidase I -
  AAVD18_RS08275 (AAVD18_08275) tapA 1582480..1583151 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  AAVD18_RS08280 (AAVD18_08280) - 1583409..1583738 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  AAVD18_RS08285 (AAVD18_08285) - 1583779..1583958 (-) 180 WP_013352866.1 YqzE family protein -
  AAVD18_RS08290 (AAVD18_08290) comGG 1584012..1584389 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  AAVD18_RS08295 (AAVD18_08295) comGF 1584391..1584891 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  AAVD18_RS08300 (AAVD18_08300) comGE 1584800..1585114 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  AAVD18_RS08305 (AAVD18_08305) comGD 1585098..1585535 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene
  AAVD18_RS08310 (AAVD18_08310) comGC 1585525..1585833 (-) 309 WP_013352870.1 competence type IV pilus major pilin ComGC Machinery gene
  AAVD18_RS08315 (AAVD18_08315) comGB 1585838..1586875 (-) 1038 WP_013352871.1 competence type IV pilus assembly protein ComGB Machinery gene
  AAVD18_RS08320 (AAVD18_08320) comGA 1586862..1587932 (-) 1071 WP_013352872.1 competence type IV pilus ATPase ComGA Machinery gene
  AAVD18_RS08325 (AAVD18_08325) - 1588126..1589076 (-) 951 WP_013352873.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11934.89 Da        Isoelectric Point: 6.2120

>NTDB_id=994696 AAVD18_RS08300 WP_014470662.1 1584800..1585114(-) (comGE) [Bacillus amyloliquefaciens strain Fad 11/2]
MQNGNKGFSTIETLSAMAIWLFLMISIVPVWTGMLTDNLKIEEHQEVYQLLHKHISAYMMSGKKQPSPDVTWKEDGDYYK
VCAAVRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=994696 AAVD18_RS08300 WP_014470662.1 1584800..1585114(-) (comGE) [Bacillus amyloliquefaciens strain Fad 11/2]
ATGCAGAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCTATTTGGCTGTTCCTTATGATTTCTAT
CGTTCCGGTCTGGACGGGCATGCTGACAGACAATCTGAAAATAGAAGAACACCAGGAAGTGTACCAGCTTCTTCATAAAC
ATATCAGCGCATATATGATGTCCGGAAAAAAGCAGCCATCTCCCGATGTGACGTGGAAGGAGGATGGTGATTATTACAAA
GTCTGTGCAGCTGTCCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment