Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AAVD18_RS08255 Genome accession   NZ_CP154893
Coordinates   1580484..1580657 (+) Length   57 a.a.
NCBI ID   WP_013352860.1    Uniprot ID   A0A9P1JIA1
Organism   Bacillus amyloliquefaciens strain Fad 11/2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1575484..1585657
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAVD18_RS08240 (AAVD18_08240) gcvT 1576295..1577395 (-) 1101 WP_013352857.1 glycine cleavage system aminomethyltransferase GcvT -
  AAVD18_RS08245 (AAVD18_08245) - 1577819..1579489 (+) 1671 WP_014470658.1 SNF2-related protein -
  AAVD18_RS08250 (AAVD18_08250) - 1579510..1580304 (+) 795 WP_013352859.1 YqhG family protein -
  AAVD18_RS08255 (AAVD18_08255) sinI 1580484..1580657 (+) 174 WP_013352860.1 anti-repressor SinI family protein Regulator
  AAVD18_RS08260 (AAVD18_08260) sinR 1580691..1581026 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  AAVD18_RS08265 (AAVD18_08265) - 1581074..1581859 (-) 786 WP_013352862.1 TasA family protein -
  AAVD18_RS08270 (AAVD18_08270) - 1581924..1582508 (-) 585 WP_013352863.1 signal peptidase I -
  AAVD18_RS08275 (AAVD18_08275) tapA 1582480..1583151 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  AAVD18_RS08280 (AAVD18_08280) - 1583409..1583738 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  AAVD18_RS08285 (AAVD18_08285) - 1583779..1583958 (-) 180 WP_013352866.1 YqzE family protein -
  AAVD18_RS08290 (AAVD18_08290) comGG 1584012..1584389 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  AAVD18_RS08295 (AAVD18_08295) comGF 1584391..1584891 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  AAVD18_RS08300 (AAVD18_08300) comGE 1584800..1585114 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  AAVD18_RS08305 (AAVD18_08305) comGD 1585098..1585535 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6689.61 Da        Isoelectric Point: 9.8173

>NTDB_id=994693 AAVD18_RS08255 WP_013352860.1 1580484..1580657(+) (sinI) [Bacillus amyloliquefaciens strain Fad 11/2]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=994693 AAVD18_RS08255 WP_013352860.1 1580484..1580657(+) (sinI) [Bacillus amyloliquefaciens strain Fad 11/2]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684


Multiple sequence alignment