Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AAVD18_RS08255 | Genome accession | NZ_CP154893 |
| Coordinates | 1580484..1580657 (+) | Length | 57 a.a. |
| NCBI ID | WP_013352860.1 | Uniprot ID | A0A9P1JIA1 |
| Organism | Bacillus amyloliquefaciens strain Fad 11/2 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1575484..1585657
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAVD18_RS08240 (AAVD18_08240) | gcvT | 1576295..1577395 (-) | 1101 | WP_013352857.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AAVD18_RS08245 (AAVD18_08245) | - | 1577819..1579489 (+) | 1671 | WP_014470658.1 | SNF2-related protein | - |
| AAVD18_RS08250 (AAVD18_08250) | - | 1579510..1580304 (+) | 795 | WP_013352859.1 | YqhG family protein | - |
| AAVD18_RS08255 (AAVD18_08255) | sinI | 1580484..1580657 (+) | 174 | WP_013352860.1 | anti-repressor SinI family protein | Regulator |
| AAVD18_RS08260 (AAVD18_08260) | sinR | 1580691..1581026 (+) | 336 | WP_014470659.1 | transcriptional regulator SinR | Regulator |
| AAVD18_RS08265 (AAVD18_08265) | - | 1581074..1581859 (-) | 786 | WP_013352862.1 | TasA family protein | - |
| AAVD18_RS08270 (AAVD18_08270) | - | 1581924..1582508 (-) | 585 | WP_013352863.1 | signal peptidase I | - |
| AAVD18_RS08275 (AAVD18_08275) | tapA | 1582480..1583151 (-) | 672 | WP_013352864.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AAVD18_RS08280 (AAVD18_08280) | - | 1583409..1583738 (+) | 330 | WP_013352865.1 | DUF3889 domain-containing protein | - |
| AAVD18_RS08285 (AAVD18_08285) | - | 1583779..1583958 (-) | 180 | WP_013352866.1 | YqzE family protein | - |
| AAVD18_RS08290 (AAVD18_08290) | comGG | 1584012..1584389 (-) | 378 | WP_013352867.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AAVD18_RS08295 (AAVD18_08295) | comGF | 1584391..1584891 (-) | 501 | WP_013352868.1 | competence type IV pilus minor pilin ComGF | - |
| AAVD18_RS08300 (AAVD18_08300) | comGE | 1584800..1585114 (-) | 315 | WP_014470662.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| AAVD18_RS08305 (AAVD18_08305) | comGD | 1585098..1585535 (-) | 438 | WP_013352869.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6689.61 Da Isoelectric Point: 9.8173
>NTDB_id=994693 AAVD18_RS08255 WP_013352860.1 1580484..1580657(+) (sinI) [Bacillus amyloliquefaciens strain Fad 11/2]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=994693 AAVD18_RS08255 WP_013352860.1 1580484..1580657(+) (sinI) [Bacillus amyloliquefaciens strain Fad 11/2]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
68.421 |
100 |
0.684 |