Detailed information    

insolico Bioinformatically predicted

Overview

Name   treR   Type   Regulator
Locus tag   AAFU62_RS08240 Genome accession   NZ_CP154891
Coordinates   1701954..1702667 (+) Length   237 a.a.
NCBI ID   WP_002982243.1    Uniprot ID   A0A9X5LXW4
Organism   Streptococcus pyogenes strain 318231     
Function   regulate expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1702947..1741345 1701954..1702667 flank 280


Gene organization within MGE regions


Location: 1701954..1741345
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAFU62_RS08240 (AAFU62_08240) treR 1701954..1702667 (+) 714 WP_002982243.1 trehalose operon repressor Regulator
  AAFU62_RS08245 (AAFU62_08245) - 1702947..1703285 (-) 339 Protein_1562 helix-turn-helix domain-containing protein -
  AAFU62_RS08250 (AAFU62_08250) - 1703471..1704328 (+) 858 WP_111711508.1 VOC family protein -
  AAFU62_RS08255 (AAFU62_08255) yaaA 1704370..1705101 (+) 732 WP_111718025.1 peroxide stress protein YaaA -
  AAFU62_RS08260 (AAFU62_08260) nrdG 1705275..1705889 (-) 615 WP_021775544.1 anaerobic ribonucleoside-triphosphate reductase activating protein -
  AAFU62_RS08265 (AAFU62_08265) - 1705904..1706398 (-) 495 WP_014407930.1 GNAT family N-acetyltransferase -
  AAFU62_RS08270 (AAFU62_08270) - 1706407..1707342 (-) 936 WP_136268349.1 Gfo/Idh/MocA family oxidoreductase -
  AAFU62_RS08275 (AAFU62_08275) - 1707371..1707517 (-) 147 WP_002982210.1 hypothetical protein -
  AAFU62_RS08280 (AAFU62_08280) nrdD 1707699..1709897 (-) 2199 WP_136130530.1 anaerobic ribonucleoside-triphosphate reductase -
  AAFU62_RS08285 (AAFU62_08285) - 1709994..1711553 (-) 1560 WP_111718027.1 DUF2079 domain-containing protein -
  AAFU62_RS08290 (AAFU62_08290) - 1711967..1712272 (-) 306 WP_002982199.1 DUF1292 domain-containing protein -
  AAFU62_RS08295 (AAFU62_08295) ruvX 1712284..1712703 (-) 420 WP_002982196.1 Holliday junction resolvase RuvX -
  AAFU62_RS08300 (AAFU62_08300) - 1712700..1712969 (-) 270 WP_002982194.1 IreB family regulatory phosphoprotein -
  AAFU62_RS08305 (AAFU62_08305) spx 1713082..1713480 (-) 399 WP_002982188.1 transcriptional regulator Spx -
  AAFU62_RS08310 (AAFU62_08310) recA 1713772..1714908 (-) 1137 WP_023612576.1 recombinase RecA Machinery gene
  AAFU62_RS08315 (AAFU62_08315) - 1714997..1716267 (-) 1271 Protein_1576 competence/damage-inducible protein A -
  AAFU62_RS08320 (AAFU62_08320) - 1716336..1716896 (-) 561 WP_011018314.1 DNA-3-methyladenine glycosylase I -
  AAFU62_RS08325 (AAFU62_08325) ruvA 1716906..1717502 (-) 597 WP_053308677.1 Holliday junction branch migration protein RuvA -
  AAFU62_RS08330 (AAFU62_08330) - 1717504..1718724 (-) 1221 WP_136268352.1 MFS transporter -
  AAFU62_RS08335 (AAFU62_08335) mutL 1718735..1720717 (-) 1983 WP_053308679.1 DNA mismatch repair endonuclease MutL -
  AAFU62_RS08340 (AAFU62_08340) mutS 1720846..1723401 (-) 2556 WP_030126180.1 DNA mismatch repair protein MutS -
  AAFU62_RS08345 (AAFU62_08345) - 1723388..1723719 (-) 332 Protein_1582 YlbF family regulator -
  AAFU62_RS08350 (AAFU62_08350) argR 1723737..1724174 (-) 438 WP_002982171.1 arginine repressor -
  AAFU62_RS08355 (AAFU62_08355) argS 1724465..1726156 (+) 1692 WP_129322346.1 arginine--tRNA ligase -
  AAFU62_RS08360 (AAFU62_08360) - 1726244..1726552 (+) 309 WP_030126179.1 bacteriocin immunity protein -
  AAFU62_RS08365 (AAFU62_08365) - 1726579..1727451 (-) 873 WP_002982164.1 YitT family protein -
  AAFU62_RS08370 (AAFU62_08370) - 1727494..1728372 (-) 879 WP_023610708.1 YitT family protein -
  AAFU62_RS08375 (AAFU62_08375) - 1728392..1729333 (-) 942 WP_129322348.1 YitT family protein -
  AAFU62_RS08380 (AAFU62_08380) aspS 1729326..1731074 (-) 1749 WP_345864242.1 aspartate--tRNA ligase -
  AAFU62_RS08385 (AAFU62_08385) hisS 1731412..1732692 (-) 1281 WP_136098202.1 histidine--tRNA ligase -
  AAFU62_RS08390 (AAFU62_08390) rpmF 1732912..1733094 (+) 183 WP_000290414.1 50S ribosomal protein L32 -
  AAFU62_RS08395 (AAFU62_08395) rpmG 1733110..1733259 (+) 150 WP_002982147.1 50S ribosomal protein L33 -
  AAFU62_RS08400 (AAFU62_08400) - 1733299..1733523 (-) 225 Protein_1593 FanG protein -
  AAFU62_RS08405 (AAFU62_08405) - 1733552..1734166 (+) 615 WP_009880708.1 CadD family cadmium resistance transporter -
  AAFU62_RS08410 (AAFU62_08410) cadX 1734178..1734516 (+) 339 WP_000711091.1 Cd(II)/Zn(II)-sensing metalloregulatory transcriptional regulator CadX -
  AAFU62_RS08415 (AAFU62_08415) - 1734560..1735975 (+) 1416 WP_168429784.1 helix-turn-helix transcriptional regulator -
  AAFU62_RS08420 (AAFU62_08420) - 1736298..1736774 (+) 477 WP_023612561.1 hypothetical protein -
  AAFU62_RS08425 (AAFU62_08425) - 1736919..1737239 (+) 321 WP_023612575.1 hypothetical protein -
  AAFU62_RS08430 (AAFU62_08430) - 1737239..1738339 (+) 1101 WP_115354343.1 type IV secretion system DNA-binding domain-containing protein -
  AAFU62_RS08435 (AAFU62_08435) - 1738336..1738941 (+) 606 WP_136268354.1 hypothetical protein -
  AAFU62_RS08440 (AAFU62_08440) - 1739145..1739750 (+) 606 WP_023612587.1 replication protein -
  AAFU62_RS08445 (AAFU62_08445) - 1739743..1739991 (+) 249 WP_023612591.1 MerR family transcriptional regulator -
  AAFU62_RS08450 (AAFU62_08450) - 1740095..1741345 (+) 1251 WP_115354345.1 site-specific integrase -

Sequence

Protein


Download         Length: 237 a.a.        Molecular weight: 27592.78 Da        Isoelectric Point: 9.6226

>NTDB_id=994665 AAFU62_RS08240 WP_002982243.1 1701954..1702667(+) (treR) [Streptococcus pyogenes strain 318231]
MTKYERIYKDLETKINKDFYKEGDFLPTEIELSQQYQASRDTVRKALSLLTKAGLILKKQGRGTQVIKHHQIMFPISELT
SYQELVSYSNLDSKTNVIAIDKLIVDETLSKLTGFSKNSLVWRVTRQRVVEGVASVLDIDYLSKTLVPIMTREIAEHSIY
QYLEKELHLAIDFALKEVTIDQITDRDKILLDLGSDQHVVSVKSKVYLSNNNQFQFTESRHKLEKFKFLDFARRRPK

Nucleotide


Download         Length: 714 bp        

>NTDB_id=994665 AAFU62_RS08240 WP_002982243.1 1701954..1702667(+) (treR) [Streptococcus pyogenes strain 318231]
ATGACAAAGTATGAACGTATTTATAAAGACCTCGAAACAAAAATAAACAAAGACTTTTACAAAGAAGGGGATTTTTTACC
TACTGAAATAGAATTGAGTCAACAGTACCAAGCTAGCCGAGATACCGTCCGCAAGGCTCTCTCGCTTCTCACTAAGGCAG
GCCTTATCCTCAAAAAACAAGGACGTGGCACCCAAGTGATTAAGCATCATCAGATCATGTTCCCCATCTCAGAACTAACT
AGCTATCAGGAACTCGTCTCTTACTCAAATCTAGATTCTAAGACCAACGTCATTGCCATTGATAAACTGATTGTGGATGA
GACACTTTCAAAATTGACCGGTTTTAGCAAAAACAGCTTGGTCTGGCGTGTTACACGCCAACGCGTTGTTGAGGGTGTGG
CTTCCGTCTTAGACATTGATTACCTTAGTAAAACTTTGGTGCCAATAATGACAAGGGAAATCGCAGAGCATTCTATTTAT
CAATATTTGGAAAAGGAACTCCATCTCGCCATTGACTTTGCCCTCAAAGAGGTTACCATTGACCAAATAACCGATCGTGA
TAAAATTTTACTTGACCTTGGATCAGACCAACATGTCGTTTCCGTCAAATCCAAAGTCTACCTTTCCAATAATAACCAAT
TCCAATTCACCGAGAGTCGCCATAAACTGGAAAAATTTAAATTTTTAGATTTTGCTCGGCGCAGACCAAAATAA

Domains

Predicted by InterproScan.

Bacterial regulatory proteins, gntR family (GntR)

(3-66)

UTRA domain (UTRA)

(91-227)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  treR Streptococcus mutans UA159

68.803

98.734

0.679

Multiple sequence alignment