Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | AAYT22_RS02345 | Genome accession | NZ_CP154876 |
| Coordinates | 452283..452432 (+) | Length | 49 a.a. |
| NCBI ID | WP_001836413.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain 20155336 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 447283..457432
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAYT22_RS02315 (AAYT22_02300) | comA/nlmT | 448350..448997 (-) | 648 | WP_078064020.1 | ATP-binding cassette domain-containing protein | Regulator |
| AAYT22_RS02320 (AAYT22_02305) | comA/nlmT | 449013..450026 (-) | 1014 | WP_318528993.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| AAYT22_RS02325 (AAYT22_02310) | comA/nlmT | 449920..450507 (-) | 588 | WP_374918082.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| AAYT22_RS02330 (AAYT22_02315) | blpI | 450789..450986 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| AAYT22_RS02335 (AAYT22_02320) | blpJ | 451453..451722 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| AAYT22_RS02340 (AAYT22_02325) | blpK | 451791..452039 (+) | 249 | WP_000379965.1 | bacteriocin-like peptide BlpK | - |
| AAYT22_RS02345 (AAYT22_02330) | cipB | 452283..452432 (+) | 150 | WP_001836413.1 | bacteriocin-like peptide BlpO | Regulator |
| AAYT22_RS02350 | - | 452468..452533 (+) | 66 | Protein_461 | ComC/BlpC family peptide pheromone/bacteriocin | - |
| AAYT22_RS02355 (AAYT22_02335) | - | 452536..452655 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| AAYT22_RS02360 (AAYT22_02340) | - | 453136..453494 (+) | 359 | Protein_463 | immunity protein | - |
| AAYT22_RS02365 (AAYT22_02345) | - | 454123..454506 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| AAYT22_RS02370 (AAYT22_02350) | - | 454558..455247 (+) | 690 | WP_000760532.1 | CPBP family intramembrane glutamic endopeptidase | - |
| AAYT22_RS02375 (AAYT22_02355) | blpZ | 455289..455522 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| AAYT22_RS02380 (AAYT22_02360) | - | 455673..456284 (+) | 612 | WP_000394036.1 | CPBP family intramembrane glutamic endopeptidase | - |
| AAYT22_RS02385 (AAYT22_02365) | ccrZ | 456445..457239 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5131.89 Da Isoelectric Point: 4.0439
>NTDB_id=994358 AAYT22_RS02345 WP_001836413.1 452283..452432(+) (cipB) [Streptococcus pneumoniae strain 20155336]
MNTKMMSQFSVIDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVIDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=994358 AAYT22_RS02345 WP_001836413.1 452283..452432(+) (cipB) [Streptococcus pneumoniae strain 20155336]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATAGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATAGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |