Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   AAIB13_RS00270 Genome accession   NZ_CP154470
Coordinates   43920..44369 (-) Length   149 a.a.
NCBI ID   WP_266199913.1    Uniprot ID   -
Organism   Pasteurella multocida strain Pm6     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 39679..87361 43920..44369 within 0


Gene organization within MGE regions


Location: 39679..87361
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAIB13_RS00240 (AAIB13_00240) - 39829..40866 (-) 1038 WP_016533424.1 tyrosine-type recombinase/integrase -
  AAIB13_RS00245 (AAIB13_00245) - 40875..41261 (-) 387 WP_016533425.1 hypothetical protein -
  AAIB13_RS00250 (AAIB13_00250) - 41377..41832 (-) 456 WP_014390696.1 hypothetical protein -
  AAIB13_RS00255 (AAIB13_00255) - 41877..42230 (-) 354 WP_041423219.1 hypothetical protein -
  AAIB13_RS00260 (AAIB13_00260) - 42239..42736 (-) 498 WP_014391445.1 DUF551 domain-containing protein -
  AAIB13_RS00265 (AAIB13_00265) rdgC 42880..43782 (-) 903 WP_014667784.1 recombination-associated protein RdgC -
  AAIB13_RS00270 (AAIB13_00270) ssb 43920..44369 (-) 450 WP_266199913.1 single-stranded DNA-binding protein Machinery gene
  AAIB13_RS00275 (AAIB13_00275) - 44369..45028 (-) 660 WP_041423209.1 translocation protein TolB precursor -
  AAIB13_RS00280 (AAIB13_00280) - 45015..45968 (-) 954 WP_014391451.1 recombinase RecT -
  AAIB13_RS00285 (AAIB13_00285) - 45970..46257 (-) 288 WP_014391452.1 hypothetical protein -
  AAIB13_RS00290 (AAIB13_00290) - 46270..46506 (-) 237 WP_343297664.1 hypothetical protein -
  AAIB13_RS00295 (AAIB13_00295) - 46478..46777 (-) 300 WP_078802174.1 hypothetical protein -
  AAIB13_RS00300 (AAIB13_00300) - 46925..47155 (+) 231 WP_223251317.1 hypothetical protein -
  AAIB13_RS00305 (AAIB13_00305) - 47217..47894 (-) 678 WP_343297665.1 Bro-N domain-containing protein -
  AAIB13_RS00310 (AAIB13_00310) - 48308..49105 (-) 798 WP_032854018.1 hypothetical protein -
  AAIB13_RS00315 (AAIB13_00315) - 49192..49455 (-) 264 WP_071522857.1 hypothetical protein -
  AAIB13_RS00320 (AAIB13_00320) - 49646..49771 (+) 126 WP_014391103.1 hypothetical protein -
  AAIB13_RS00325 (AAIB13_00325) - 49772..50305 (-) 534 WP_014391102.1 hypothetical protein -
  AAIB13_RS00330 (AAIB13_00330) - 50393..50656 (-) 264 WP_071522857.1 hypothetical protein -
  AAIB13_RS00335 (AAIB13_00335) - 50868..51062 (+) 195 WP_014391459.1 hypothetical protein -
  AAIB13_RS00340 (AAIB13_00340) - 51043..51213 (-) 171 WP_014391460.1 hypothetical protein -
  AAIB13_RS00345 (AAIB13_00345) - 51226..51456 (-) 231 WP_075271373.1 hypothetical protein -
  AAIB13_RS00350 (AAIB13_00350) - 51698..51907 (-) 210 WP_005756656.1 hypothetical protein -
  AAIB13_RS00355 (AAIB13_00355) - 51920..52087 (+) 168 WP_005756653.1 DUF1508 domain-containing protein -
  AAIB13_RS00360 (AAIB13_00360) - 52392..52706 (+) 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin -
  AAIB13_RS00365 (AAIB13_00365) - 52703..52993 (+) 291 WP_265176302.1 addiction module antidote protein -
  AAIB13_RS00370 (AAIB13_00370) - 53020..53940 (-) 921 WP_265164248.1 hypothetical protein -
  AAIB13_RS00375 (AAIB13_00375) - 54031..54687 (-) 657 WP_016570077.1 XRE family transcriptional regulator -
  AAIB13_RS00380 (AAIB13_00380) - 54818..55024 (+) 207 WP_071523618.1 helix-turn-helix transcriptional regulator -
  AAIB13_RS00385 (AAIB13_00385) - 55073..55534 (+) 462 WP_267174535.1 phage regulatory CII family protein -
  AAIB13_RS00390 (AAIB13_00390) - 55593..56294 (+) 702 WP_252759492.1 phage antirepressor KilAC domain-containing protein -
  AAIB13_RS00395 (AAIB13_00395) - 56291..56506 (+) 216 WP_075271368.1 hypothetical protein -
  AAIB13_RS00400 (AAIB13_00400) - 56503..57315 (+) 813 WP_343297666.1 helix-turn-helix domain-containing protein -
  AAIB13_RS00405 (AAIB13_00405) - 57315..58004 (+) 690 WP_252759562.1 replication protein P -
  AAIB13_RS00410 (AAIB13_00410) - 58008..58544 (+) 537 WP_014391470.1 phage N-6-adenine-methyltransferase -
  AAIB13_RS00415 (AAIB13_00415) - 58534..58992 (+) 459 WP_014391471.1 recombination protein NinB -
  AAIB13_RS00420 (AAIB13_00420) - 59066..59281 (+) 216 WP_225529666.1 hypothetical protein -
  AAIB13_RS00425 (AAIB13_00425) - 59274..59876 (+) 603 WP_170376544.1 recombination protein NinG -
  AAIB13_RS00430 (AAIB13_00430) - 59877..60338 (+) 462 WP_014667792.1 antiterminator Q family protein -
  AAIB13_RS00435 (AAIB13_00435) - 60469..60663 (+) 195 WP_064964940.1 hypothetical protein -
  AAIB13_RS00440 (AAIB13_00440) - 60775..60960 (+) 186 WP_143813468.1 hypothetical protein -
  AAIB13_RS00445 (AAIB13_00445) - 61080..61418 (+) 339 WP_252759427.1 phage holin, lambda family -
  AAIB13_RS00450 (AAIB13_00450) - 61433..62017 (+) 585 WP_252759428.1 glycoside hydrolase family 19 protein -
  AAIB13_RS00455 (AAIB13_00455) - 62020..62343 (+) 324 WP_170354761.1 DUF2570 family protein -
  AAIB13_RS00460 (AAIB13_00460) - 62553..62921 (-) 369 WP_014391478.1 helix-turn-helix transcriptional regulator -
  AAIB13_RS00465 (AAIB13_00465) - 62957..63217 (-) 261 WP_005720780.1 type II toxin-antitoxin system RelE/ParE family toxin -
  AAIB13_RS00470 (AAIB13_00470) - 63507..63980 (+) 474 WP_014391479.1 DUF1441 family protein -
  AAIB13_RS00475 (AAIB13_00475) - 63984..66092 (+) 2109 WP_014391480.1 phage terminase large subunit family protein -
  AAIB13_RS00480 (AAIB13_00480) - 66089..66310 (+) 222 WP_014391481.1 hypothetical protein -
  AAIB13_RS00485 (AAIB13_00485) - 66307..67845 (+) 1539 WP_099803045.1 phage portal protein -
  AAIB13_RS00490 (AAIB13_00490) - 67781..69787 (+) 2007 WP_343297638.1 ClpP-like prohead protease/major capsid protein fusion protein -
  AAIB13_RS00495 (AAIB13_00495) - 69859..70185 (+) 327 WP_005719720.1 capsid cement protein -
  AAIB13_RS00500 (AAIB13_00500) - 70178..70471 (+) 294 WP_014391484.1 hypothetical protein -
  AAIB13_RS00505 (AAIB13_00505) - 70471..71022 (+) 552 WP_014391485.1 phage tail protein -
  AAIB13_RS00510 (AAIB13_00510) gpU 71019..71426 (+) 408 WP_014391486.1 phage tail terminator protein -
  AAIB13_RS00515 (AAIB13_00515) - 71423..71929 (+) 507 WP_078819785.1 phage tail tube protein -
  AAIB13_RS00520 (AAIB13_00520) - 71935..72324 (+) 390 WP_016533230.1 phage minor tail protein G -
  AAIB13_RS00525 (AAIB13_00525) - 72345..72647 (+) 303 WP_225529681.1 phage tail assembly protein T -
  AAIB13_RS00530 (AAIB13_00530) - 72634..75027 (+) 2394 WP_225529664.1 phage tail length tape measure family protein -
  AAIB13_RS00535 (AAIB13_00535) - 75024..75374 (+) 351 WP_005719622.1 phage tail protein -
  AAIB13_RS00540 (AAIB13_00540) - 75446..76012 (+) 567 WP_078819667.1 hypothetical protein -
  AAIB13_RS00545 (AAIB13_00545) - 76166..76870 (+) 705 WP_078819787.1 phage minor tail protein L -
  AAIB13_RS00550 (AAIB13_00550) - 76875..77618 (+) 744 WP_275836934.1 C40 family peptidase -
  AAIB13_RS00555 (AAIB13_00555) - 77561..78151 (+) 591 WP_042743292.1 tail assembly protein -
  AAIB13_RS00560 (AAIB13_00560) - 78155..84940 (+) 6786 WP_343297667.1 phage tail protein -
  AAIB13_RS00565 (AAIB13_00565) - 84988..85311 (+) 324 WP_014390761.1 hypothetical protein -
  AAIB13_RS00570 (AAIB13_00570) - 85702..86448 (-) 747 WP_014390762.1 hypothetical protein -
  AAIB13_RS00575 (AAIB13_00575) - 86448..86960 (-) 513 WP_014390763.1 hypothetical protein -

Sequence

Protein


Download         Length: 149 a.a.        Molecular weight: 17024.90 Da        Isoelectric Point: 6.9835

>NTDB_id=993529 AAIB13_RS00270 WP_266199913.1 43920..44369(-) (ssb) [Pasteurella multocida strain Pm6]
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKSGKPVQKFDNFEEDDIPF

Nucleotide


Download         Length: 450 bp        

>NTDB_id=993529 AAIB13_RS00270 WP_266199913.1 43920..44369(-) (ssb) [Pasteurella multocida strain Pm6]
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAAGTGGAA
AACCAGTGCAGAAGTTTGATAATTTTGAAGAAGACGATATACCGTTTTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-108)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

61.878

100

0.752
  ssb Vibrio cholerae strain A1552

52.518

93.289

0.49
  ssb Neisseria meningitidis MC58

39.548

100

0.47
  ssb Neisseria gonorrhoeae MS11

43.796

91.946

0.403

Multiple sequence alignment