Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   AAIB12_RS00405 Genome accession   NZ_CP154469
Coordinates   66102..66554 (-) Length   150 a.a.
NCBI ID   WP_014390703.1    Uniprot ID   -
Organism   Pasteurella multocida strain Pm3     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 60714..108614 66102..66554 within 0


Gene organization within MGE regions


Location: 60714..108614
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAIB12_RS00385 (AAIB12_00385) - 60714..61124 (-) 411 WP_010907416.1 hypothetical protein -
  AAIB12_RS00390 (AAIB12_00390) - 61126..63162 (-) 2037 WP_010907417.1 integrase -
  AAIB12_RS00395 (AAIB12_00395) - 63165..64685 (-) 1521 WP_010907418.1 site-specific integrase -
  AAIB12_RS00400 (AAIB12_00400) - 64672..65958 (-) 1287 WP_005631039.1 site-specific integrase -
  AAIB12_RS00405 (AAIB12_00405) ssb 66102..66554 (-) 453 WP_014390703.1 single-stranded DNA-binding protein Machinery gene
  AAIB12_RS00410 (AAIB12_00410) - 66565..67266 (-) 702 WP_014390704.1 ERF family protein -
  AAIB12_RS00415 (AAIB12_00415) - 67309..67959 (-) 651 WP_267174441.1 ribonuclease H-like domain-containing protein -
  AAIB12_RS00420 (AAIB12_00420) - 67962..68549 (-) 588 WP_343298258.1 AP2 domain-containing protein -
  AAIB12_RS00425 (AAIB12_00425) - 68723..68884 (-) 162 WP_167383025.1 hypothetical protein -
  AAIB12_RS00430 (AAIB12_00430) - 68887..69087 (-) 201 WP_143931649.1 hypothetical protein -
  AAIB12_RS00435 (AAIB12_00435) - 69050..69298 (-) 249 WP_078737825.1 hypothetical protein -
  AAIB12_RS00440 (AAIB12_00440) - 69384..70067 (-) 684 WP_078737824.1 BRO family protein -
  AAIB12_RS00445 (AAIB12_00445) - 70349..70891 (-) 543 WP_078737823.1 DUF4760 domain-containing protein -
  AAIB12_RS00455 (AAIB12_00455) - 71623..71817 (+) 195 WP_078737822.1 hypothetical protein -
  AAIB12_RS00460 (AAIB12_00460) - 71798..71968 (-) 171 WP_155295599.1 hypothetical protein -
  AAIB12_RS00465 (AAIB12_00465) - 71981..72211 (-) 231 WP_078737821.1 hypothetical protein -
  AAIB12_RS00470 (AAIB12_00470) - 72453..72662 (-) 210 WP_005756656.1 hypothetical protein -
  AAIB12_RS00475 (AAIB12_00475) - 72675..72842 (+) 168 WP_005756653.1 DUF1508 domain-containing protein -
  AAIB12_RS00480 (AAIB12_00480) - 73233..73490 (+) 258 WP_078737820.1 hypothetical protein -
  AAIB12_RS00485 (AAIB12_00485) - 73483..73875 (-) 393 WP_078737819.1 hypothetical protein -
  AAIB12_RS00490 (AAIB12_00490) - 73875..74228 (-) 354 WP_078737818.1 DUF4325 domain-containing protein -
  AAIB12_RS00495 (AAIB12_00495) - 74203..75129 (-) 927 WP_078737817.1 hypothetical protein -
  AAIB12_RS00500 (AAIB12_00500) - 75262..75939 (-) 678 WP_014390718.1 XRE family transcriptional regulator -
  AAIB12_RS00505 (AAIB12_00505) - 76063..76260 (+) 198 WP_014390719.1 helix-turn-helix domain-containing protein -
  AAIB12_RS00510 (AAIB12_00510) - 76310..76762 (+) 453 WP_014390720.1 phage regulatory CII family protein -
  AAIB12_RS00515 (AAIB12_00515) - 76814..77497 (+) 684 WP_078737816.1 phage antirepressor KilAC domain-containing protein -
  AAIB12_RS00520 (AAIB12_00520) - 77494..77847 (+) 354 WP_014390722.1 HNH endonuclease signature motif containing protein -
  AAIB12_RS00525 (AAIB12_00525) - 77849..78751 (+) 903 WP_078802168.1 hypothetical protein -
  AAIB12_RS00530 (AAIB12_00530) - 78751..79446 (+) 696 WP_078802167.1 replication protein P -
  AAIB12_RS00535 (AAIB12_00535) - 79439..79969 (+) 531 WP_078801820.1 MT-A70 family methyltransferase -
  AAIB12_RS00540 (AAIB12_00540) - 79978..80415 (+) 438 WP_064965060.1 DUF1367 family protein -
  AAIB12_RS00545 (AAIB12_00545) - 80575..80790 (+) 216 WP_078801821.1 hypothetical protein -
  AAIB12_RS00550 (AAIB12_00550) - 80783..81385 (+) 603 WP_078801822.1 recombination protein NinG -
  AAIB12_RS00555 (AAIB12_00555) - 81387..81848 (+) 462 WP_078801823.1 antiterminator Q family protein -
  AAIB12_RS00565 (AAIB12_00565) - 82175..82435 (+) 261 WP_014391475.1 holin -
  AAIB12_RS00570 (AAIB12_00570) - 82432..82962 (+) 531 WP_078737811.1 lysozyme -
  AAIB12_RS00575 (AAIB12_00575) - 82935..83258 (+) 324 WP_078801840.1 DUF2570 family protein -
  AAIB12_RS00580 (AAIB12_00580) - 83480..83914 (-) 435 WP_014390736.1 type II toxin-antitoxin system HicB family antitoxin -
  AAIB12_RS00585 (AAIB12_00585) - 83943..84125 (-) 183 WP_016533497.1 type II toxin-antitoxin system HicA family toxin -
  AAIB12_RS00590 (AAIB12_00590) - 84208..84705 (+) 498 WP_343298259.1 helix-turn-helix domain-containing protein -
  AAIB12_RS00595 (AAIB12_00595) - 84689..85915 (+) 1227 WP_078801824.1 PBSX family phage terminase large subunit -
  AAIB12_RS00600 (AAIB12_00600) - 85930..87375 (+) 1446 WP_014390739.1 phage portal protein -
  AAIB12_RS00605 (AAIB12_00605) - 87329..88300 (+) 972 WP_014390740.1 phage minor head protein -
  AAIB12_RS00610 (AAIB12_00610) - 88315..89661 (+) 1347 WP_014390741.1 DUF2213 domain-containing protein -
  AAIB12_RS00615 (AAIB12_00615) - 89661..90095 (+) 435 WP_014390742.1 hypothetical protein -
  AAIB12_RS00620 (AAIB12_00620) - 90107..91105 (+) 999 WP_078801825.1 major capsid protein -
  AAIB12_RS00625 (AAIB12_00625) - 91116..91466 (+) 351 WP_250012870.1 hypothetical protein -
  AAIB12_RS00630 (AAIB12_00630) - 91447..91815 (+) 369 WP_014390745.1 hypothetical protein -
  AAIB12_RS00635 (AAIB12_00635) - 91818..92162 (+) 345 WP_014390746.1 hypothetical protein -
  AAIB12_RS00640 (AAIB12_00640) - 92167..92538 (+) 372 WP_014390747.1 hypothetical protein -
  AAIB12_RS00645 (AAIB12_00645) - 92535..92906 (+) 372 WP_014390748.1 hypothetical protein -
  AAIB12_RS00650 (AAIB12_00650) - 92918..93400 (+) 483 WP_014390749.1 phage tail protein -
  AAIB12_RS00655 (AAIB12_00655) - 93454..94125 (+) 672 WP_014390750.1 DUF6246 family protein -
  AAIB12_RS00660 (AAIB12_00660) - 94202..94558 (+) 357 WP_014390751.1 TM2 domain-containing protein -
  AAIB12_RS00665 (AAIB12_00665) - 94634..95452 (-) 819 WP_014390752.1 hypothetical protein -
  AAIB12_RS00670 (AAIB12_00670) - 95791..96615 (+) 825 WP_014390754.1 phage antirepressor N-terminal domain-containing protein -
  AAIB12_RS00675 (AAIB12_00675) - 96667..99111 (+) 2445 WP_014390755.1 phage tail length tape measure family protein -
  AAIB12_RS00680 (AAIB12_00680) - 99114..99443 (+) 330 WP_014390756.1 phage tail protein -
  AAIB12_RS00685 (AAIB12_00685) - 99572..100276 (+) 705 WP_078801828.1 phage minor tail protein L -
  AAIB12_RS00690 (AAIB12_00690) - 100281..101024 (+) 744 WP_078801829.1 C40 family peptidase -
  AAIB12_RS00695 (AAIB12_00695) - 100967..101587 (+) 621 WP_014667799.1 tail assembly protein -
  AAIB12_RS00700 (AAIB12_00700) - 101591..106594 (+) 5004 WP_343298260.1 phage tail protein -
  AAIB12_RS00705 (AAIB12_00705) - 106642..106965 (+) 324 WP_014667801.1 hypothetical protein -
  AAIB12_RS00710 (AAIB12_00710) - 107356..108102 (-) 747 WP_014390762.1 hypothetical protein -
  AAIB12_RS00715 (AAIB12_00715) - 108102..108614 (-) 513 WP_014390763.1 hypothetical protein -

Sequence


Protein


Download         Length: 150 a.a.        Molecular weight: 17063.94 Da        Isoelectric Point: 7.9707

>NTDB_id=993507 AAIB12_RS00405 WP_014390703.1 66102..66554(-) (ssb) [Pasteurella multocida strain Pm3]
MAGVNKVIIVGNLGNDPEIRTMPNGDPVAKISVATSESWIDKNTGERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQAYNFEEDNIPF

Nucleotide


Download         Length: 453 bp        

>NTDB_id=993507 AAIB12_RS00405 WP_014390703.1 66102..66554(-) (ssb) [Pasteurella multocida strain Pm3]
ATGGCAGGTGTTAATAAAGTAATTATCGTGGGAAATTTGGGAAACGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTTGCAAAAATCAGCGTCGCAACCAGTGAAAGCTGGATCGACAAAAATACTGGCGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGTCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCATATAACTTTGAAGAGGATAATATCCCATTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

62.222

100

0.747

  ssb Vibrio cholerae strain A1552

53.957

92.667

0.5

  ssb Neisseria gonorrhoeae MS11

46.715

91.333

0.427

  ssb Neisseria meningitidis MC58

46.715

91.333

0.427


Multiple sequence alignment