Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   AAHT66_RS03725 Genome accession   NZ_CP154441
Coordinates   698066..698587 (+) Length   173 a.a.
NCBI ID   WP_039074877.1    Uniprot ID   -
Organism   Bacillus inaquosorum strain XN303     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 695037..734297 698066..698587 within 0


Gene organization within MGE regions


Location: 695037..734297
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAHT66_RS03715 (AAHT66_03715) ychF 696527..697627 (+) 1101 WP_087993755.1 redox-regulated ATPase YchF -
  AAHT66_RS03720 (AAHT66_03720) rpsF 697738..698025 (+) 288 WP_014115888.1 30S ribosomal protein S6 -
  AAHT66_RS03725 (AAHT66_03725) ssbA 698066..698587 (+) 522 WP_039074877.1 single-stranded DNA-binding protein SsbA Machinery gene
  AAHT66_RS03730 (AAHT66_03730) rpsR 698631..698870 (+) 240 WP_010332656.1 30S ribosomal protein S18 -
  AAHT66_RS03735 (AAHT66_03735) xth 698932..699690 (+) 759 WP_333516303.1 exodeoxyribonuclease III -
  AAHT66_RS03740 (AAHT66_03740) - 699749..700684 (+) 936 WP_333516304.1 LacI family DNA-binding transcriptional regulator -
  AAHT66_RS03745 (AAHT66_03745) - 700746..701126 (+) 381 WP_333516305.1 VOC family protein -
  AAHT66_RS03750 (AAHT66_03750) - 701166..701696 (+) 531 WP_333516306.1 sugar O-acetyltransferase -
  AAHT66_RS03755 (AAHT66_03755) - 701731..703086 (-) 1356 WP_253268761.1 MFS transporter -
  AAHT66_RS03760 (AAHT66_03760) - 703313..704212 (+) 900 WP_087993768.1 CPBP family intramembrane glutamic endopeptidase -
  AAHT66_RS03765 (AAHT66_03765) - 704209..706098 (-) 1890 WP_419800348.1 thioredoxin domain-containing protein -
  AAHT66_RS03770 (AAHT66_03770) - 706137..706298 (-) 162 WP_202656597.1 DUF255 domain-containing protein -
  AAHT66_RS03775 (AAHT66_03775) - 706375..706785 (-) 411 WP_419800349.1 hypothetical protein -
  AAHT66_RS03780 (AAHT66_03780) - 707063..708259 (+) 1197 WP_419800350.1 Rap family tetratricopeptide repeat protein -
  AAHT66_RS03785 (AAHT66_03785) - 708371..708901 (-) 531 WP_419800351.1 ImmA/IrrE family metallo-endopeptidase -
  AAHT66_RS03790 (AAHT66_03790) - 708898..709281 (-) 384 WP_019716391.1 helix-turn-helix domain-containing protein -
  AAHT66_RS03795 (AAHT66_03795) - 709576..709755 (+) 180 WP_419800352.1 ICEBs1 excisionase -
  AAHT66_RS03800 (AAHT66_03800) - 709752..710012 (+) 261 WP_419800353.1 hypothetical protein -
  AAHT66_RS03805 (AAHT66_03805) - 710066..710326 (+) 261 WP_419800354.1 hypothetical protein -
  AAHT66_RS03810 (AAHT66_03810) - 710532..710648 (+) 117 WP_152535308.1 hypothetical protein -
  AAHT66_RS03815 (AAHT66_03815) helP 710696..711076 (+) 381 WP_080624161.1 helicase processivity factor HelP -
  AAHT66_RS03820 (AAHT66_03820) conQ 711112..712554 (+) 1443 WP_419800355.1 coupling conjugation protein ConQ -
  AAHT66_RS03825 (AAHT66_03825) nicK 712547..713605 (+) 1059 WP_419800356.1 DNA relaxase NicK -
  AAHT66_RS03830 (AAHT66_03830) - 713870..714136 (+) 267 WP_080624164.1 hypothetical protein -
  AAHT66_RS03835 (AAHT66_03835) - 714148..714465 (+) 318 WP_080624165.1 hypothetical protein -
  AAHT66_RS03840 (AAHT66_03840) - 714478..714756 (+) 279 WP_080624166.1 hypothetical protein -
  AAHT66_RS03845 (AAHT66_03845) - 714774..714923 (+) 150 WP_003328171.1 hypothetical protein -
  AAHT66_RS03850 (AAHT66_03850) - 714951..716015 (+) 1065 WP_419800357.1 conjugal transfer protein -
  AAHT66_RS03855 (AAHT66_03855) conC 716027..716275 (+) 249 WP_003328173.1 transposon conjugation system subunit ConC -
  AAHT66_RS03860 (AAHT66_03860) - 716288..716812 (+) 525 WP_072174271.1 conjugal transfer protein -
  AAHT66_RS03865 (AAHT66_03865) conE 716700..719195 (+) 2496 WP_419800358.1 VirB4-like ATPase ConE -
  AAHT66_RS03870 (AAHT66_03870) - 719213..719539 (+) 327 WP_019716380.1 YddF family protein -
  AAHT66_RS03875 (AAHT66_03875) - 719543..721984 (+) 2442 WP_419800359.1 hypothetical protein -
  AAHT66_RS03880 (AAHT66_03880) - 721981..722970 (+) 990 WP_419800360.1 bifunctional lytic transglycosylase/C40 family peptidase -
  AAHT66_RS03885 (AAHT66_03885) - 722985..723491 (+) 507 WP_419800361.1 hypothetical protein -
  AAHT66_RS03890 (AAHT66_03890) - 723554..723934 (+) 381 WP_072183628.1 cystatin-like fold lipoprotein -
  AAHT66_RS03895 (AAHT66_03895) - 724011..725519 (-) 1509 WP_419800362.1 recombinase family protein -
  AAHT66_RS03900 (AAHT66_03900) - 725628..726359 (+) 732 WP_229148186.1 hypothetical protein -
  AAHT66_RS03905 (AAHT66_03905) - 726386..726610 (-) 225 WP_419800363.1 DUF255 domain-containing protein -
  AAHT66_RS03910 (AAHT66_03910) - 727058..727639 (+) 582 WP_333516307.1 Crp/Fnr family transcriptional regulator -
  AAHT66_RS03915 (AAHT66_03915) - 727767..728783 (+) 1017 WP_087993763.1 NAD-dependent epimerase/dehydratase family protein -
  AAHT66_RS03920 (AAHT66_03920) - 728778..729065 (-) 288 WP_087993764.1 recombinase family protein -
  AAHT66_RS03925 (AAHT66_03925) - 729195..729364 (-) 170 Protein_724 DUF255 domain-containing protein -
  AAHT66_RS03930 (AAHT66_03930) - 729437..730354 (-) 918 WP_087993765.1 DMT family transporter -
  AAHT66_RS03935 (AAHT66_03935) - 730351..730764 (-) 414 WP_087993766.1 MerR family transcriptional regulator -
  AAHT66_RS03940 (AAHT66_03940) - 730919..731008 (-) 90 Protein_727 thioredoxin domain-containing protein -
  AAHT66_RS03945 (AAHT66_03945) - 731271..732110 (-) 840 WP_202327750.1 hypothetical protein -
  AAHT66_RS03950 (AAHT66_03950) - 732195..732761 (-) 567 WP_333516308.1 dihydrofolate reductase family protein -
  AAHT66_RS03955 (AAHT66_03955) - 732921..733277 (-) 357 WP_333516309.1 MmcQ/YjbR family DNA-binding protein -
  AAHT66_RS03960 (AAHT66_03960) - 733373..733540 (-) 168 Protein_731 DUF255 domain-containing protein -

Sequence


Protein


Download         Length: 173 a.a.        Molecular weight: 18829.38 Da        Isoelectric Point: 4.7621

>NTDB_id=993330 AAHT66_RS03725 WP_039074877.1 698066..698587(+) (ssbA) [Bacillus inaquosorum strain XN303]
MLNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAENVANFLKKGSLAGVDGRLQTR
NYENQQGQRVFVTEVQAESVQFLEPKSGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNNQRRNQGNSFNDDPFAND
GKPIDISDDDLPF

Nucleotide


Download         Length: 522 bp        

>NTDB_id=993330 AAHT66_RS03725 WP_039074877.1 698066..698587(+) (ssbA) [Bacillus inaquosorum strain XN303]
ATGCTTAACCGAGTTGTATTAGTCGGAAGACTGACAAAAGACCCAGAGCTTCGTTATACGCCAAACGGTGCGGCTGTTGC
CACGTTTACTCTTGCTGTGAATCGTACGTTTACGAACCAGTCCGGAGAACGTGAAGCCGATTTCATTAATTGTGTCACTT
GGAGAAGACAAGCTGAAAACGTTGCAAACTTCCTGAAAAAAGGAAGCCTTGCAGGCGTAGATGGCCGTTTACAAACAAGA
AACTATGAAAACCAGCAAGGACAGCGTGTCTTCGTGACCGAAGTTCAAGCTGAAAGTGTTCAGTTTCTTGAGCCTAAAAG
CGGCGGCGGTTCTGGTTCAGGTGGATACAACGAAGGAAACAGCGGCGGAGGCCAGTACTTTGGCGGAGGCCAAAATGATA
ATCCATTCGGGGGAAATCAGAACAACAACCAGAGACGCAATCAGGGAAACAGCTTTAATGATGACCCGTTTGCCAACGAC
GGCAAACCGATTGACATCTCGGATGATGATCTTCCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

98.844

100

0.988

  ssb Latilactobacillus sakei subsp. sakei 23K

57.303

100

0.59

  ssbB Bacillus subtilis subsp. subtilis str. 168

64.151

61.272

0.393

  ssb Glaesserella parasuis strain SC1401

35.87

100

0.382


Multiple sequence alignment