Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | GZ111_RS11500 | Genome accession | NZ_CP152420 |
| Coordinates | 2370063..2370533 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934772.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 17-021 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2346779..2400308 | 2370063..2370533 | within | 0 |
Gene organization within MGE regions
Location: 2346779..2400308
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GZ111_RS11350 (GZ111_011350) | - | 2346779..2347405 (-) | 627 | WP_000522381.1 | nitroreductase family protein | - |
| GZ111_RS11355 (GZ111_011355) | - | 2347602..2348861 (+) | 1260 | WP_162651077.1 | SdrH family protein | - |
| GZ111_RS11360 (GZ111_011360) | mroQ | 2348886..2349629 (-) | 744 | WP_343031693.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| GZ111_RS11365 (GZ111_011365) | groES | 2349804..2350088 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| GZ111_RS11370 (GZ111_011370) | groL | 2350164..2351780 (+) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| GZ111_RS11375 (GZ111_011375) | - | 2352320..2353627 (-) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| GZ111_RS11380 (GZ111_011380) | - | 2354071..2355294 (-) | 1224 | WP_000206625.1 | ArgE/DapE family deacylase | - |
| GZ111_RS11385 (GZ111_011385) | lukH | 2355730..2356785 (+) | 1056 | WP_000791411.1 | bi-component leukocidin LukGH subunit H | - |
| GZ111_RS11390 (GZ111_011390) | lukG | 2356807..2357823 (+) | 1017 | WP_000595392.1 | bi-component leukocidin LukGH subunit G | - |
| GZ111_RS11395 (GZ111_011395) | sph | 2358061..2358891 (-) | 831 | Protein_2235 | sphingomyelin phosphodiesterase | - |
| GZ111_RS11400 (GZ111_011400) | - | 2358942..2359979 (-) | 1038 | WP_000857198.1 | site-specific integrase | - |
| GZ111_RS11405 (GZ111_011405) | - | 2360152..2360691 (-) | 540 | WP_000391618.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| GZ111_RS11410 (GZ111_011410) | - | 2360831..2360998 (-) | 168 | WP_000705238.1 | hypothetical protein | - |
| GZ111_RS11415 (GZ111_011415) | - | 2361198..2361383 (-) | 186 | WP_001089804.1 | hypothetical protein | - |
| GZ111_RS11420 (GZ111_011420) | - | 2361370..2361525 (-) | 156 | WP_001049399.1 | hypothetical protein | - |
| GZ111_RS11425 (GZ111_011425) | - | 2361537..2362244 (-) | 708 | WP_000094093.1 | XRE family transcriptional regulator | - |
| GZ111_RS11430 (GZ111_011430) | - | 2362415..2362654 (+) | 240 | WP_000548578.1 | helix-turn-helix transcriptional regulator | - |
| GZ111_RS11435 (GZ111_011435) | - | 2362667..2362927 (+) | 261 | WP_000435341.1 | transcriptional regulator | - |
| GZ111_RS11440 (GZ111_011440) | - | 2362951..2363490 (-) | 540 | WP_000351243.1 | hypothetical protein | - |
| GZ111_RS11445 (GZ111_011445) | - | 2363547..2364299 (+) | 753 | WP_001148618.1 | phage antirepressor KilAC domain-containing protein | - |
| GZ111_RS11450 (GZ111_011450) | - | 2364316..2364510 (+) | 195 | WP_000388066.1 | hypothetical protein | - |
| GZ111_RS11455 (GZ111_011455) | - | 2364541..2364681 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| GZ111_RS11460 (GZ111_011460) | - | 2364696..2365328 (-) | 633 | WP_000275058.1 | hypothetical protein | - |
| GZ111_RS11465 (GZ111_011465) | - | 2365387..2365707 (+) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| GZ111_RS11470 (GZ111_011470) | - | 2365704..2365865 (+) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| GZ111_RS11475 (GZ111_011475) | - | 2365958..2366218 (+) | 261 | WP_000291489.1 | DUF1108 family protein | - |
| GZ111_RS11480 (GZ111_011480) | - | 2366227..2366490 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| GZ111_RS11485 (GZ111_011485) | - | 2366499..2368442 (+) | 1944 | WP_000700565.1 | AAA family ATPase | - |
| GZ111_RS11490 (GZ111_011490) | - | 2368444..2369364 (+) | 921 | WP_000138471.1 | recombinase RecT | - |
| GZ111_RS11495 (GZ111_011495) | - | 2369445..2370062 (+) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| GZ111_RS11500 (GZ111_011500) | ssbA | 2370063..2370533 (+) | 471 | WP_000934772.1 | single-stranded DNA-binding protein | Machinery gene |
| GZ111_RS11505 (GZ111_011505) | - | 2370563..2371456 (+) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| GZ111_RS11510 (GZ111_011510) | - | 2371463..2371681 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| GZ111_RS11515 (GZ111_011515) | - | 2371690..2372145 (+) | 456 | WP_000401965.1 | RusA family crossover junction endodeoxyribonuclease | - |
| GZ111_RS11520 (GZ111_011520) | - | 2372158..2372526 (+) | 369 | WP_000101270.1 | SA1788 family PVL leukocidin-associated protein | - |
| GZ111_RS11525 (GZ111_011525) | - | 2372530..2372772 (+) | 243 | WP_000131381.1 | phi PVL orf 51-like protein | - |
| GZ111_RS11530 (GZ111_011530) | - | 2372787..2373041 (+) | 255 | WP_086045083.1 | DUF1024 family protein | - |
| GZ111_RS11535 (GZ111_011535) | - | 2373028..2373189 (+) | 162 | WP_000714417.1 | hypothetical protein | - |
| GZ111_RS11540 (GZ111_011540) | - | 2373189..2373725 (+) | 537 | WP_000185669.1 | dUTP diphosphatase | - |
| GZ111_RS11545 (GZ111_011545) | - | 2373762..2374007 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| GZ111_RS11550 (GZ111_011550) | - | 2374004..2374210 (+) | 207 | WP_047216556.1 | DUF1381 domain-containing protein | - |
| GZ111_RS11555 (GZ111_011555) | - | 2374207..2374356 (+) | 150 | WP_031761843.1 | transcriptional regulator | - |
| GZ111_RS11560 (GZ111_011560) | - | 2374515..2375165 (+) | 651 | WP_001005262.1 | hypothetical protein | - |
| GZ111_RS11565 (GZ111_011565) | - | 2375165..2375365 (+) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| GZ111_RS11570 (GZ111_011570) | - | 2375393..2375809 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| GZ111_RS11575 (GZ111_011575) | - | 2376041..2376340 (+) | 300 | WP_000988330.1 | HNH endonuclease | - |
| GZ111_RS11580 (GZ111_011580) | - | 2376471..2376815 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| GZ111_RS11585 (GZ111_011585) | - | 2376812..2378473 (+) | 1662 | WP_162650989.1 | terminase large subunit | - |
| GZ111_RS11590 (GZ111_011590) | - | 2378489..2379676 (+) | 1188 | WP_000025274.1 | phage portal protein | - |
| GZ111_RS11595 (GZ111_011595) | - | 2379660..2380397 (+) | 738 | WP_000861914.1 | head maturation protease, ClpP-related | - |
| GZ111_RS11600 (GZ111_011600) | - | 2380421..2381566 (+) | 1146 | WP_000154555.1 | phage major capsid protein | - |
| GZ111_RS11605 (GZ111_011605) | - | 2381586..2381870 (+) | 285 | WP_000238236.1 | hypothetical protein | - |
| GZ111_RS11610 (GZ111_011610) | - | 2381860..2382144 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| GZ111_RS11615 (GZ111_011615) | - | 2382128..2382490 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| GZ111_RS11620 (GZ111_011620) | - | 2382487..2382891 (+) | 405 | WP_000114225.1 | HK97 gp10 family phage protein | - |
| GZ111_RS11625 (GZ111_011625) | - | 2382888..2383295 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| GZ111_RS11630 (GZ111_011630) | - | 2383296..2383940 (+) | 645 | WP_000268740.1 | major tail protein | - |
| GZ111_RS11635 (GZ111_011635) | - | 2383994..2384206 (+) | 213 | WP_078101489.1 | Ig-like domain-containing protein | - |
| GZ111_RS11640 (GZ111_011640) | - | 2384256..2384606 (+) | 351 | WP_001096355.1 | hypothetical protein | - |
| GZ111_RS11645 (GZ111_011645) | - | 2384657..2384794 (+) | 138 | WP_001549167.1 | hypothetical protein | - |
| GZ111_RS11650 (GZ111_011650) | - | 2384851..2389395 (+) | 4545 | WP_086045082.1 | phage tail tape measure protein | - |
| GZ111_RS11655 (GZ111_011655) | - | 2389392..2390876 (+) | 1485 | WP_000567408.1 | phage tail domain-containing protein | - |
| GZ111_RS11660 (GZ111_011660) | - | 2390892..2394677 (+) | 3786 | WP_000582158.1 | phage tail spike protein | - |
| GZ111_RS11665 (GZ111_011665) | - | 2394667..2394819 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| GZ111_RS11670 (GZ111_011670) | - | 2394866..2395153 (+) | 288 | WP_001040261.1 | hypothetical protein | - |
| GZ111_RS11675 (GZ111_011675) | - | 2395211..2395507 (+) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| GZ111_RS11680 (GZ111_011680) | pepG1 | 2395699..2395833 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| GZ111_RS11685 (GZ111_011685) | - | 2395886..2395993 (-) | 108 | WP_001791821.1 | hypothetical protein | - |
| GZ111_RS11690 (GZ111_011690) | - | 2396045..2396299 (+) | 255 | WP_000611512.1 | phage holin | - |
| GZ111_RS11695 (GZ111_011695) | - | 2396311..2397066 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| GZ111_RS11700 (GZ111_011700) | sak | 2397257..2397748 (+) | 492 | WP_000919350.1 | staphylokinase | - |
| GZ111_RS11705 (GZ111_011705) | - | 2398398..2398732 (+) | 335 | Protein_2297 | SH3 domain-containing protein | - |
| GZ111_RS11710 (GZ111_011710) | - | 2398827..2399276 (-) | 450 | WP_000727651.1 | chemotaxis-inhibiting protein CHIPS | - |
| GZ111_RS11715 (GZ111_011715) | scn | 2399958..2400308 (+) | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17657.52 Da Isoelectric Point: 5.2672
>NTDB_id=989227 GZ111_RS11500 WP_000934772.1 2370063..2370533(+) (ssbA) [Staphylococcus aureus strain 17-021]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=989227 GZ111_RS11500 WP_000934772.1 2370063..2370533(+) (ssbA) [Staphylococcus aureus strain 17-021]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |