Detailed information
Bioinformatically predicted
Overview
| Name | cclA/cilC | Type | Machinery gene |
| Locus tag | R8570_RS08565 | Genome accession | NZ_AP026932 |
| Coordinates | 1705981..1706640 (+) | Length | 219 a.a. |
| NCBI ID | WP_000565010.1 | Uniprot ID | A0A0B7M2C6 |
| Organism | Streptococcus pneumoniae strain PZ900701549 | ||
| Function | processing and translocation of ComGC; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1676368..1725897 | 1705981..1706640 | within | 0 |
Gene organization within MGE regions
Location: 1676368..1725897
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R8570_RS08395 (PC1528_16900) | - | 1676368..1678551 (-) | 2184 | WP_000529017.1 | S8 family peptidase | - |
| R8570_RS08400 (PC1528_16910) | - | 1678613..1679647 (-) | 1035 | WP_000747915.1 | ATP-binding protein | - |
| R8570_RS08405 (PC1528_16920) | - | 1679766..1679915 (-) | 150 | Protein_1663 | 7,8-dihydro-8-oxoguanine-triphosphatase | - |
| R8570_RS08410 (PC1528_16930) | - | 1679917..1680984 (-) | 1068 | WP_000719723.1 | site-2 protease family protein | - |
| R8570_RS08415 (PC1528_16940) | - | 1681003..1681473 (-) | 471 | WP_000257084.1 | DUF3013 family protein | - |
| R8570_RS08420 (PC1528_16950) | - | 1681764..1682216 (-) | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| R8570_RS08425 (PC1528_16960) | - | 1682253..1682432 (-) | 180 | WP_001132285.1 | type II toxin-antitoxin system HicA family toxin | - |
| R8570_RS08430 (PC1528_16970) | - | 1682569..1682748 (-) | 180 | WP_001048906.1 | hypothetical protein | - |
| R8570_RS08435 (PC1528_16980) | - | 1682913..1683152 (-) | 240 | WP_000818078.1 | hypothetical protein | - |
| R8570_RS08440 (PC1528_16990) | - | 1683422..1684693 (+) | 1272 | WP_001113218.1 | replication-associated recombination protein A | - |
| R8570_RS08450 (PC1528_17000) | - | 1685240..1686559 (-) | 1320 | WP_050263892.1 | glycoside hydrolase family 32 protein | - |
| R8570_RS08455 (PC1528_17010) | - | 1686569..1687414 (-) | 846 | WP_000819520.1 | carbohydrate ABC transporter permease | - |
| R8570_RS08460 (PC1528_17020) | - | 1687416..1688318 (-) | 903 | WP_000032532.1 | carbohydrate ABC transporter permease | - |
| R8570_RS08465 (PC1528_17030) | - | 1688414..1689724 (-) | 1311 | WP_001225468.1 | sugar ABC transporter substrate-binding protein | - |
| R8570_RS08470 (PC1528_17040) | - | 1689851..1690846 (-) | 996 | WP_000230210.1 | LacI family DNA-binding transcriptional regulator | - |
| R8570_RS08475 (PC1528_17050) | mgaSpn | 1691208..1692689 (-) | 1482 | WP_001205280.1 | virulence factor transcriptional regulator MgaSpn | - |
| R8570_RS08480 (PC1528_17060) | - | 1693132..1693296 (+) | 165 | WP_001809002.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| R8570_RS08485 | amaP | 1693380..1693946 (+) | 567 | WP_000030213.1 | alkaline shock response membrane anchor protein AmaP | - |
| R8570_RS08490 (PC1528_17080) | - | 1693958..1694128 (+) | 171 | WP_000455066.1 | DUF2273 domain-containing protein | - |
| R8570_RS08495 (PC1528_17090) | - | 1694167..1694775 (+) | 609 | WP_000064115.1 | Asp23/Gls24 family envelope stress response protein | - |
| R8570_RS08500 (PC1528_17100) | - | 1694806..1695009 (+) | 204 | WP_000109957.1 | CsbD family protein | - |
| R8570_RS08505 (PC1528_17110) | - | 1695119..1695358 (-) | 240 | WP_001005783.1 | transposase | - |
| R8570_RS08510 | - | 1695636..1695881 (+) | 246 | WP_001809004.1 | IS30 family transposase | - |
| R8570_RS08515 (PC1528_17120) | - | 1696159..1696929 (-) | 771 | WP_000229328.1 | sulfite exporter TauE/SafE family protein | - |
| R8570_RS08520 (PC1528_17130) | - | 1696944..1697792 (-) | 849 | WP_000782429.1 | formylglycine-generating enzyme family protein | - |
| R8570_RS08525 (PC1528_17140) | - | 1697789..1699264 (-) | 1476 | WP_000250870.1 | arylsulfatase | - |
| R8570_RS08530 (PC1528_17150) | - | 1699587..1700942 (-) | 1356 | WP_001094994.1 | PTS sugar transporter subunit IIC | - |
| R8570_RS08535 (PC1528_17160) | - | 1700952..1701269 (-) | 318 | WP_001005881.1 | PTS lactose/cellobiose transporter subunit IIA | - |
| R8570_RS08540 (PC1528_17170) | - | 1701286..1701603 (-) | 318 | WP_001151646.1 | PTS sugar transporter subunit IIB | - |
| R8570_RS08545 (PC1528_17180) | - | 1701618..1702514 (-) | 897 | WP_000825669.1 | PEP phosphonomutase | - |
| R8570_RS08550 (PC1528_17190) | - | 1702517..1703779 (-) | 1263 | WP_000413336.1 | PTS sugar transporter subunit IIC | - |
| R8570_RS08555 (PC1528_17200) | - | 1704059..1705237 (+) | 1179 | WP_000175876.1 | ROK family transcriptional regulator | - |
| R8570_RS08560 (PC1528_17210) | - | 1705513..1705911 (-) | 399 | WP_000155403.1 | N-acetyltransferase | - |
| R8570_RS08565 (PC1528_17220) | cclA/cilC | 1705981..1706640 (+) | 660 | WP_000565010.1 | A24 family peptidase | Machinery gene |
| R8570_RS08570 (PC1528_17230) | - | 1706692..1707843 (-) | 1152 | WP_000481756.1 | XRE family transcriptional regulator | - |
| R8570_RS08575 (PC1528_17240) | - | 1707858..1708589 (-) | 732 | WP_000934016.1 | hypothetical protein | - |
| R8570_RS08580 | - | 1708809..1708919 (+) | 111 | Protein_1697 | prepilin peptidase | - |
| R8570_RS08585 (PC1528_17250) | trpA | 1708891..1709667 (-) | 777 | WP_050102522.1 | tryptophan synthase subunit alpha | - |
| R8570_RS08590 (PC1528_17260) | trpB | 1709660..1710883 (-) | 1224 | WP_000331293.1 | tryptophan synthase subunit beta | - |
| R8570_RS08595 (PC1528_17270) | - | 1710861..1711460 (-) | 600 | WP_050099763.1 | phosphoribosylanthranilate isomerase | - |
| R8570_RS08600 (PC1528_17280) | trpC | 1711447..1712214 (-) | 768 | WP_000076548.1 | indole-3-glycerol phosphate synthase TrpC | - |
| R8570_RS08605 (PC1528_17290) | trpD | 1712211..1713215 (-) | 1005 | WP_000658684.1 | anthranilate phosphoribosyltransferase | - |
| R8570_RS08610 (PC1528_17300) | - | 1713226..1713792 (-) | 567 | WP_000601926.1 | aminodeoxychorismate/anthranilate synthase component II | - |
| R8570_RS08615 (PC1528_17310) | trpE | 1713789..1715150 (-) | 1362 | WP_050122713.1 | anthranilate synthase component I | - |
| R8570_RS08620 | - | 1715285..1715440 (-) | 156 | WP_000413545.1 | hypothetical protein | - |
| R8570_RS08625 (PC1528_17320) | - | 1715523..1715864 (-) | 342 | WP_257885117.1 | hypothetical protein | - |
| R8570_RS08630 (PC1528_17330) | - | 1716472..1717473 (-) | 1002 | WP_000789949.1 | LacI family DNA-binding transcriptional regulator | - |
| R8570_RS08635 (PC1528_17340) | - | 1717581..1717949 (-) | 369 | WP_050263831.1 | hypothetical protein | - |
| R8570_RS08640 (PC1528_17350) | - | 1718045..1718755 (-) | 711 | WP_000127552.1 | MgtC/SapB family protein | - |
| R8570_RS08645 (PC1528_17360) | - | 1718758..1720449 (-) | 1692 | WP_001216185.1 | iron ABC transporter permease | - |
| R8570_RS08650 (PC1528_17370) | - | 1720461..1721471 (-) | 1011 | WP_000589142.1 | ABC transporter ATP-binding protein | - |
| R8570_RS08655 (PC1528_17380) | - | 1721575..1722642 (-) | 1068 | WP_000738372.1 | extracellular solute-binding protein | - |
| R8570_RS08660 (PC1528_17390) | - | 1722667..1723326 (-) | 660 | WP_050263832.1 | DUF1868 domain-containing protein | - |
| R8570_RS08665 (PC1528_17400) | - | 1723563..1723859 (-) | 297 | WP_000239026.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 219 a.a. Molecular weight: 24845.99 Da Isoelectric Point: 7.5762
>NTDB_id=98907 R8570_RS08565 WP_000565010.1 1705981..1706640(+) (cclA/cilC) [Streptococcus pneumoniae strain PZ900701549]
MIDFYFFLVGSILASFLGLVIDRFPEQSIISSASHCDSCQTRLRPLDLIPILSQVFNRFCCRYCKVRYPVWYALFELGLG
LLFLLYSWELLSLSQVILITAGLTLGIYDFRHQEYPLLVWMTFHLILIASSGWNLVMVSFLILGILAHFIDIRMGAGDFL
FLASCALVFSVTELLILIQFASATGILAFLLQKKKERLPFVPFLLLAACVIIFGKLLLV
MIDFYFFLVGSILASFLGLVIDRFPEQSIISSASHCDSCQTRLRPLDLIPILSQVFNRFCCRYCKVRYPVWYALFELGLG
LLFLLYSWELLSLSQVILITAGLTLGIYDFRHQEYPLLVWMTFHLILIASSGWNLVMVSFLILGILAHFIDIRMGAGDFL
FLASCALVFSVTELLILIQFASATGILAFLLQKKKERLPFVPFLLLAACVIIFGKLLLV
Nucleotide
Download Length: 660 bp
>NTDB_id=98907 R8570_RS08565 WP_000565010.1 1705981..1706640(+) (cclA/cilC) [Streptococcus pneumoniae strain PZ900701549]
ATGATTGATTTTTATTTTTTTCTCGTCGGGAGCATTCTCGCTTCCTTTCTTGGTTTGGTCATTGACCGTTTTCCAGAGCA
ATCCATTATCAGTTCAGCCAGTCACTGCGATTCCTGTCAGACTCGCTTGCGTCCCTTAGATTTGATTCCGATTCTCTCAC
AGGTCTTCAATCGCTTTTGCTGTCGCTACTGCAAGGTCCGCTATCCTGTCTGGTATGCCCTCTTTGAACTAGGCTTAGGA
CTCCTCTTTCTGCTTTACTCTTGGGAATTACTTTCCTTGAGTCAAGTCATCCTAATCACTGCTGGTTTGACCTTGGGCAT
CTACGACTTTCGCCATCAGGAATATCCCTTACTGGTCTGGATGACTTTCCACCTAATCCTAATAGCTTCCTCTGGCTGGA
ATCTGGTCATGGTCTCCTTCCTCATACTTGGAATTTTGGCTCATTTTATCGATATCCGCATGGGTGCAGGGGATTTCCTT
TTTTTAGCTTCTTGCGCTCTCGTCTTTAGCGTAACGGAGTTACTGATCTTGATTCAGTTCGCTTCTGCGACGGGTATCCT
GGCCTTTCTCCTGCAAAAGAAAAAGGAAAGACTTCCTTTCGTGCCTTTCCTCTTACTTGCTGCTTGTGTGATTATTTTTG
GTAAGCTACTGCTTGTCTGA
ATGATTGATTTTTATTTTTTTCTCGTCGGGAGCATTCTCGCTTCCTTTCTTGGTTTGGTCATTGACCGTTTTCCAGAGCA
ATCCATTATCAGTTCAGCCAGTCACTGCGATTCCTGTCAGACTCGCTTGCGTCCCTTAGATTTGATTCCGATTCTCTCAC
AGGTCTTCAATCGCTTTTGCTGTCGCTACTGCAAGGTCCGCTATCCTGTCTGGTATGCCCTCTTTGAACTAGGCTTAGGA
CTCCTCTTTCTGCTTTACTCTTGGGAATTACTTTCCTTGAGTCAAGTCATCCTAATCACTGCTGGTTTGACCTTGGGCAT
CTACGACTTTCGCCATCAGGAATATCCCTTACTGGTCTGGATGACTTTCCACCTAATCCTAATAGCTTCCTCTGGCTGGA
ATCTGGTCATGGTCTCCTTCCTCATACTTGGAATTTTGGCTCATTTTATCGATATCCGCATGGGTGCAGGGGATTTCCTT
TTTTTAGCTTCTTGCGCTCTCGTCTTTAGCGTAACGGAGTTACTGATCTTGATTCAGTTCGCTTCTGCGACGGGTATCCT
GGCCTTTCTCCTGCAAAAGAAAAAGGAAAGACTTCCTTTCGTGCCTTTCCTCTTACTTGCTGCTTGTGTGATTATTTTTG
GTAAGCTACTGCTTGTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cclA/cilC | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| cclA/cilC | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| cclA/cilC | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| cclA/cilC | Streptococcus pneumoniae TIGR4 |
94.977 |
100 |
0.95 |
| cclA/cilC | Streptococcus mitis SK321 |
92.694 |
100 |
0.927 |
| cclA/cilC | Streptococcus mitis NCTC 12261 |
87.671 |
100 |
0.877 |