Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | V9953_RS05255 | Genome accession | NZ_CP152374 |
| Coordinates | 1130098..1130607 (-) | Length | 169 a.a. |
| NCBI ID | WP_017827452.1 | Uniprot ID | - |
| Organism | Proteus mirabilis strain PM190 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1126828..1175278 | 1130098..1130607 | within | 0 |
Gene organization within MGE regions
Location: 1126828..1175278
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V9953_RS05225 (V9953_05225) | - | 1126828..1127829 (-) | 1002 | WP_026164649.1 | tyrosine-type recombinase/integrase | - |
| V9953_RS05230 (V9953_05230) | - | 1127786..1128031 (-) | 246 | WP_004246013.1 | excisionase | - |
| V9953_RS05235 (V9953_05235) | - | 1128066..1128668 (-) | 603 | Protein_994 | MT-A70 family methyltransferase | - |
| V9953_RS05240 (V9953_05240) | - | 1128655..1128882 (-) | 228 | WP_134736555.1 | hypothetical protein | - |
| V9953_RS05245 (V9953_05245) | - | 1129029..1129208 (-) | 180 | WP_134736554.1 | hypothetical protein | - |
| V9953_RS05250 (V9953_05250) | - | 1129343..1130026 (-) | 684 | WP_134736553.1 | hypothetical protein | - |
| V9953_RS05255 (V9953_05255) | ssb | 1130098..1130607 (-) | 510 | WP_017827452.1 | single-stranded DNA-binding protein | Machinery gene |
| V9953_RS05260 (V9953_05260) | - | 1130607..1131218 (-) | 612 | WP_017827451.1 | ERF family protein | - |
| V9953_RS05265 (V9953_05265) | - | 1131220..1131540 (-) | 321 | WP_017628824.1 | hypothetical protein | - |
| V9953_RS05270 (V9953_05270) | - | 1131537..1131689 (-) | 153 | WP_167649897.1 | hypothetical protein | - |
| V9953_RS05275 (V9953_05275) | - | 1131689..1132123 (-) | 435 | WP_196573078.1 | SAM-dependent methyltransferase | - |
| V9953_RS05280 (V9953_05280) | - | 1132156..1132410 (-) | 255 | WP_134736552.1 | hypothetical protein | - |
| V9953_RS05285 (V9953_05285) | - | 1132418..1132573 (-) | 156 | WP_164484711.1 | hypothetical protein | - |
| V9953_RS05290 (V9953_05290) | - | 1132662..1132889 (-) | 228 | WP_004247466.1 | hypothetical protein | - |
| V9953_RS05295 (V9953_05295) | - | 1133012..1133287 (-) | 276 | WP_134736551.1 | hypothetical protein | - |
| V9953_RS05300 (V9953_05300) | - | 1133452..1133637 (+) | 186 | WP_004247469.1 | hypothetical protein | - |
| V9953_RS05305 (V9953_05305) | - | 1133634..1133786 (-) | 153 | WP_004247470.1 | hypothetical protein | - |
| V9953_RS05310 (V9953_05310) | - | 1133972..1134187 (+) | 216 | WP_135024233.1 | hypothetical protein | - |
| V9953_RS05315 (V9953_05315) | - | 1134184..1134399 (-) | 216 | WP_135024230.1 | hypothetical protein | - |
| V9953_RS05320 (V9953_05320) | - | 1134408..1134725 (-) | 318 | WP_017827445.1 | hypothetical protein | - |
| V9953_RS05325 (V9953_05325) | - | 1135170..1135625 (-) | 456 | WP_060556508.1 | hypothetical protein | - |
| V9953_RS05330 (V9953_05330) | - | 1135622..1136200 (-) | 579 | WP_060556509.1 | toxin-antitoxin system HicB family antitoxin | - |
| V9953_RS05335 (V9953_05335) | - | 1136197..1136496 (-) | 300 | WP_060556510.1 | hypothetical protein | - |
| V9953_RS05340 (V9953_05340) | - | 1136561..1137205 (-) | 645 | WP_163801707.1 | LexA family transcriptional regulator | - |
| V9953_RS05345 (V9953_05345) | - | 1137311..1137520 (+) | 210 | WP_004247477.1 | helix-turn-helix transcriptional regulator | - |
| V9953_RS05350 (V9953_05350) | - | 1137666..1138013 (+) | 348 | WP_004247478.1 | hypothetical protein | - |
| V9953_RS05355 (V9953_05355) | - | 1138109..1138282 (+) | 174 | WP_172409601.1 | hypothetical protein | - |
| V9953_RS05360 (V9953_05360) | - | 1138279..1139046 (+) | 768 | WP_060556512.1 | helix-turn-helix domain-containing protein | - |
| V9953_RS05365 (V9953_05365) | - | 1139046..1140431 (+) | 1386 | WP_012367618.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| V9953_RS05370 (V9953_05370) | - | 1140457..1140906 (+) | 450 | WP_012367619.1 | YbcN family protein | - |
| V9953_RS05375 (V9953_05375) | - | 1140985..1141275 (+) | 291 | WP_004245984.1 | DUF1364 domain-containing protein | - |
| V9953_RS05380 (V9953_05380) | - | 1141272..1141628 (+) | 357 | WP_004245983.1 | RusA family crossover junction endodeoxyribonuclease | - |
| V9953_RS05385 (V9953_05385) | - | 1141628..1142260 (+) | 633 | WP_004247487.1 | bacteriophage antitermination protein Q | - |
| V9953_RS05390 (V9953_05390) | - | 1142571..1143092 (+) | 522 | WP_004247148.1 | DUF1440 domain-containing protein | - |
| V9953_RS05395 (V9953_05395) | - | 1143251..1143673 (+) | 423 | WP_004247488.1 | hypothetical protein | - |
| V9953_RS05400 (V9953_05400) | - | 1143727..1143996 (+) | 270 | WP_004247489.1 | hypothetical protein | - |
| V9953_RS05405 (V9953_05405) | - | 1143996..1144466 (+) | 471 | WP_080047831.1 | lysozyme | - |
| V9953_RS05410 (V9953_05410) | - | 1144448..1144606 (+) | 159 | WP_012367623.1 | hypothetical protein | - |
| V9953_RS05415 (V9953_05415) | - | 1144609..1145070 (+) | 462 | WP_163801711.1 | lysis protein | - |
| V9953_RS05420 (V9953_05420) | - | 1145418..1146002 (+) | 585 | WP_004247494.1 | Bro-N domain-containing protein | - |
| V9953_RS05425 (V9953_05425) | - | 1146202..1146360 (+) | 159 | WP_004245978.1 | hypothetical protein | - |
| V9953_RS05430 (V9953_05430) | - | 1146394..1146996 (+) | 603 | WP_004247495.1 | hypothetical protein | - |
| V9953_RS05435 (V9953_05435) | - | 1146999..1148486 (+) | 1488 | WP_004247496.1 | hypothetical protein | - |
| V9953_RS05440 (V9953_05440) | - | 1148486..1149856 (+) | 1371 | WP_004247497.1 | DUF4055 domain-containing protein | - |
| V9953_RS05445 (V9953_05445) | - | 1149853..1150974 (+) | 1122 | WP_004247498.1 | hypothetical protein | - |
| V9953_RS05450 (V9953_05450) | - | 1151044..1151289 (+) | 246 | WP_004247499.1 | hypothetical protein | - |
| V9953_RS05455 (V9953_05455) | - | 1151386..1152147 (+) | 762 | WP_004247500.1 | hypothetical protein | - |
| V9953_RS05460 (V9953_05460) | - | 1152161..1153114 (+) | 954 | WP_004247501.1 | major capsid protein | - |
| V9953_RS05465 (V9953_05465) | - | 1153141..1153401 (+) | 261 | WP_257747798.1 | Ig-like domain-containing protein | - |
| V9953_RS05470 (V9953_05470) | - | 1153441..1153920 (+) | 480 | WP_004245968.1 | DnaT-like ssDNA-binding protein | - |
| V9953_RS05475 (V9953_05475) | - | 1153923..1154273 (+) | 351 | WP_004247502.1 | hypothetical protein | - |
| V9953_RS05480 (V9953_05480) | - | 1154275..1154856 (+) | 582 | WP_004247503.1 | hypothetical protein | - |
| V9953_RS05485 (V9953_05485) | - | 1154853..1155254 (+) | 402 | WP_004247504.1 | phage tail terminator-like protein | - |
| V9953_RS05490 (V9953_05490) | - | 1155300..1155956 (+) | 657 | WP_004247505.1 | phage tail protein | - |
| V9953_RS05495 (V9953_05495) | - | 1156008..1156313 (+) | 306 | WP_004245960.1 | phage tail assembly chaperone | - |
| V9953_RS05500 (V9953_05500) | - | 1156328..1156615 (+) | 288 | WP_051008871.1 | DUF1799 domain-containing protein | - |
| V9953_RS05505 (V9953_05505) | - | 1156644..1156850 (-) | 207 | WP_004247508.1 | hypothetical protein | - |
| V9953_RS05510 (V9953_05510) | - | 1157003..1157374 (+) | 372 | WP_004247509.1 | hypothetical protein | - |
| V9953_RS05515 (V9953_05515) | - | 1157388..1157570 (-) | 183 | WP_004247510.1 | hypothetical protein | - |
| V9953_RS05520 (V9953_05520) | - | 1157905..1158906 (+) | 1002 | WP_109880200.1 | hypothetical protein | - |
| V9953_RS05525 (V9953_05525) | - | 1159179..1160012 (-) | 834 | WP_046334559.1 | phage antirepressor N-terminal domain-containing protein | - |
| V9953_RS05530 (V9953_05530) | - | 1160082..1160243 (-) | 162 | WP_004245955.1 | toxin-antitoxin system HicB family antitoxin | - |
| V9953_RS05535 (V9953_05535) | - | 1160357..1160614 (+) | 258 | WP_046334560.1 | Arc family DNA-binding protein | - |
| V9953_RS05540 (V9953_05540) | - | 1160611..1161504 (+) | 894 | WP_049257266.1 | DNA translocase FtsK | - |
| V9953_RS05545 (V9953_05545) | - | 1161542..1162411 (+) | 870 | WP_046334561.1 | hypothetical protein | - |
| V9953_RS05550 (V9953_05550) | - | 1162471..1165410 (+) | 2940 | WP_004247511.1 | phage tail tape measure protein | - |
| V9953_RS05555 (V9953_05555) | - | 1165433..1165645 (+) | 213 | WP_004247512.1 | hypothetical protein | - |
| V9953_RS05560 (V9953_05560) | - | 1165685..1165975 (+) | 291 | WP_004247513.1 | hypothetical protein | - |
| V9953_RS05565 (V9953_05565) | - | 1165995..1166339 (-) | 345 | WP_240088322.1 | hypothetical protein | - |
| V9953_RS05570 (V9953_05570) | - | 1166339..1166680 (+) | 342 | WP_004247516.1 | phage tail protein | - |
| V9953_RS05575 (V9953_05575) | - | 1166677..1167420 (+) | 744 | WP_004247517.1 | phage minor tail protein L | - |
| V9953_RS05580 (V9953_05580) | - | 1167417..1168127 (+) | 711 | WP_004247518.1 | C40 family peptidase | - |
| V9953_RS05585 (V9953_05585) | - | 1168124..1168729 (+) | 606 | WP_004247519.1 | tail assembly protein | - |
| V9953_RS05590 (V9953_05590) | - | 1168781..1172974 (+) | 4194 | WP_004247520.1 | DUF1983 domain-containing protein | - |
| V9953_RS05595 (V9953_05595) | - | 1172980..1173336 (+) | 357 | WP_223307229.1 | hypothetical protein | - |
| V9953_RS05600 (V9953_05600) | - | 1173338..1173952 (+) | 615 | WP_004247523.1 | hypothetical protein | - |
| V9953_RS05605 (V9953_05605) | - | 1174002..1174262 (+) | 261 | WP_004247524.1 | hypothetical protein | - |
| V9953_RS05610 (V9953_05610) | - | 1174402..1174641 (+) | 240 | WP_166470157.1 | hypothetical protein | - |
| V9953_RS05615 (V9953_05615) | - | 1174973..1175278 (-) | 306 | WP_004247526.1 | helix-turn-helix transcriptional regulator | - |
Sequence
Protein
Download Length: 169 a.a. Molecular weight: 19066.43 Da Isoelectric Point: 6.9903
>NTDB_id=988721 V9953_RS05255 WP_017827452.1 1130098..1130607(-) (ssb) [Proteus mirabilis strain PM190]
MASKGVNKVLLIGHLGQDPEMRYLPNGDAVTNITLATSDSWKDKQSGETKERVEWHRVVIFGKLAEIAGEYLRKGSQVYI
EGQLQTRKWQDQNGQDRYSTEVVVNINGSMQILGNNNQAGSQKSQPSPHQHGWSLQQSPKRNEPPMDFDDDIPFAPIGLM
YPRHLINII
MASKGVNKVLLIGHLGQDPEMRYLPNGDAVTNITLATSDSWKDKQSGETKERVEWHRVVIFGKLAEIAGEYLRKGSQVYI
EGQLQTRKWQDQNGQDRYSTEVVVNINGSMQILGNNNQAGSQKSQPSPHQHGWSLQQSPKRNEPPMDFDDDIPFAPIGLM
YPRHLINII
Nucleotide
Download Length: 510 bp
>NTDB_id=988721 V9953_RS05255 WP_017827452.1 1130098..1130607(-) (ssb) [Proteus mirabilis strain PM190]
ATGGCAAGTAAAGGTGTAAACAAAGTCTTATTGATAGGACATCTAGGTCAAGATCCTGAAATGCGTTACCTCCCAAATGG
CGATGCAGTTACTAATATTACATTAGCCACCAGCGATTCATGGAAAGATAAACAATCAGGTGAAACCAAGGAACGTGTCG
AATGGCATAGAGTTGTGATATTTGGAAAGCTCGCCGAAATTGCTGGCGAATATCTGCGTAAAGGTTCACAAGTCTATATC
GAAGGTCAATTACAAACACGTAAATGGCAAGATCAAAATGGACAAGACAGATACAGCACGGAAGTTGTAGTGAATATTAA
TGGCTCAATGCAAATTTTAGGTAACAACAATCAGGCTGGTAGCCAGAAATCACAACCATCACCTCATCAACACGGATGGA
GCCTTCAACAATCTCCTAAGCGTAATGAACCTCCAATGGATTTTGATGATGATATTCCTTTTGCGCCGATTGGGCTTATG
TATCCACGACATTTGATTAATATAATTTAG
ATGGCAAGTAAAGGTGTAAACAAAGTCTTATTGATAGGACATCTAGGTCAAGATCCTGAAATGCGTTACCTCCCAAATGG
CGATGCAGTTACTAATATTACATTAGCCACCAGCGATTCATGGAAAGATAAACAATCAGGTGAAACCAAGGAACGTGTCG
AATGGCATAGAGTTGTGATATTTGGAAAGCTCGCCGAAATTGCTGGCGAATATCTGCGTAAAGGTTCACAAGTCTATATC
GAAGGTCAATTACAAACACGTAAATGGCAAGATCAAAATGGACAAGACAGATACAGCACGGAAGTTGTAGTGAATATTAA
TGGCTCAATGCAAATTTTAGGTAACAACAATCAGGCTGGTAGCCAGAAATCACAACCATCACCTCATCAACACGGATGGA
GCCTTCAACAATCTCCTAAGCGTAATGAACCTCCAATGGATTTTGATGATGATATTCCTTTTGCGCCGATTGGGCTTATG
TATCCACGACATTTGATTAATATAATTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
63.277 |
100 |
0.663 |
| ssb | Glaesserella parasuis strain SC1401 |
47.753 |
100 |
0.503 |
| ssb | Neisseria gonorrhoeae MS11 |
42.045 |
100 |
0.438 |
| ssb | Neisseria meningitidis MC58 |
42.045 |
100 |
0.438 |