Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NYE42_RS15780 Genome accession   NZ_CP152036
Coordinates   3187060..3187200 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus sp. FSL K6-2865     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3182060..3192200
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYE42_RS15755 (NYE42_15735) - 3182356..3182739 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  NYE42_RS15760 (NYE42_15740) comA 3182761..3183405 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  NYE42_RS15765 (NYE42_15745) comP 3183486..3185795 (-) 2310 WP_352426576.1 histidine kinase Regulator
  NYE42_RS15770 (NYE42_15750) comX 3185815..3185991 (-) 177 WP_007408675.1 competence pheromone ComX -
  NYE42_RS15775 (NYE42_15755) comQ 3185991..3186875 (-) 885 WP_061862640.1 class 1 isoprenoid biosynthesis enzyme Regulator
  NYE42_RS15780 (NYE42_15760) degQ 3187060..3187200 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  NYE42_RS15785 (NYE42_15765) - 3187666..3188007 (+) 342 WP_069006914.1 hypothetical protein -
  NYE42_RS15790 (NYE42_15770) - 3188014..3189237 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  NYE42_RS15795 (NYE42_15775) - 3189367..3190833 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  NYE42_RS15800 (NYE42_15780) - 3190851..3191402 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  NYE42_RS15805 (NYE42_15785) - 3191499..3191897 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=986159 NYE42_RS15780 WP_003152043.1 3187060..3187200(-) (degQ) [Bacillus sp. FSL K6-2865]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=986159 NYE42_RS15780 WP_003152043.1 3187060..3187200(-) (degQ) [Bacillus sp. FSL K6-2865]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAATAAAAGCATTGATCAGCTCGATAAATTCTCATATGCTATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment