Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   AADZ70_RS07535 Genome accession   NZ_CP151679
Coordinates   1538018..1538332 (-) Length   104 a.a.
NCBI ID   WP_045926718.1    Uniprot ID   -
Organism   Bacillus sp. YBsi01     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1533018..1543332
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AADZ70_RS07490 (AADZ70_07490) sinI 1533701..1533874 (+) 174 WP_016938977.1 anti-repressor SinI family protein Regulator
  AADZ70_RS07495 (AADZ70_07495) sinR 1533908..1534243 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AADZ70_RS07500 (AADZ70_07500) - 1534291..1535076 (-) 786 WP_047475632.1 TasA family protein -
  AADZ70_RS07505 (AADZ70_07505) - 1535140..1535724 (-) 585 WP_016938975.1 signal peptidase I -
  AADZ70_RS07510 (AADZ70_07510) tapA 1535696..1536367 (-) 672 WP_029575370.1 amyloid fiber anchoring/assembly protein TapA -
  AADZ70_RS07515 (AADZ70_07515) - 1536626..1536955 (+) 330 WP_016938972.1 DUF3889 domain-containing protein -
  AADZ70_RS07520 (AADZ70_07520) - 1536995..1537174 (-) 180 WP_016938971.1 YqzE family protein -
  AADZ70_RS07525 (AADZ70_07525) comGG 1537231..1537608 (-) 378 WP_342007946.1 competence type IV pilus minor pilin ComGG -
  AADZ70_RS07530 (AADZ70_07530) comGF 1537609..1538106 (-) 498 WP_342007947.1 competence type IV pilus minor pilin ComGF -
  AADZ70_RS07535 (AADZ70_07535) comGE 1538018..1538332 (-) 315 WP_045926718.1 competence type IV pilus minor pilin ComGE Machinery gene
  AADZ70_RS07540 (AADZ70_07540) comGD 1538316..1538753 (-) 438 WP_045926719.1 competence type IV pilus minor pilin ComGD Machinery gene
  AADZ70_RS07545 (AADZ70_07545) comGC 1538743..1539009 (-) 267 WP_045926801.1 competence type IV pilus major pilin ComGC Machinery gene
  AADZ70_RS07550 (AADZ70_07550) comGB 1539056..1540093 (-) 1038 WP_342007948.1 competence type IV pilus assembly protein ComGB Machinery gene
  AADZ70_RS07555 (AADZ70_07555) comGA 1540080..1541150 (-) 1071 WP_045926720.1 competence type IV pilus ATPase ComGA Machinery gene
  AADZ70_RS07560 (AADZ70_07560) - 1541343..1542293 (-) 951 WP_049627017.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11930.90 Da        Isoelectric Point: 7.7788

>NTDB_id=979681 AADZ70_RS07535 WP_045926718.1 1538018..1538332(-) (comGE) [Bacillus sp. YBsi01]
MQNGNKGFSTIETLSAMAIWLFLMISIVPVWTDMLTDNLKTEERQKARQLLQERISAYMMSGKKQPSPGVTWKEEGDYYK
VCAAVRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=979681 AADZ70_RS07535 WP_045926718.1 1538018..1538332(-) (comGE) [Bacillus sp. YBsi01]
ATGCAGAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTTCTTATGATTTCTAT
CGTTCCGGTCTGGACGGACATGCTGACGGATAATCTGAAAACAGAGGAACGCCAAAAAGCGCGCCAGCTTCTCCAGGAAC
GCATCAGCGCTTATATGATGTCCGGAAAAAAGCAGCCGTCTCCCGGTGTGACGTGGAAGGAGGAAGGTGATTATTACAAA
GTCTGTGCGGCTGTCCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

45.946

100

0.49

Multiple sequence alignment