Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   AADZ70_RS07490 Genome accession   NZ_CP151679
Coordinates   1533701..1533874 (+) Length   57 a.a.
NCBI ID   WP_016938977.1    Uniprot ID   -
Organism   Bacillus sp. YBsi01     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1528701..1538874
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AADZ70_RS07475 (AADZ70_07475) gcvT 1529513..1530613 (-) 1101 WP_342007945.1 glycine cleavage system aminomethyltransferase GcvT -
  AADZ70_RS07480 (AADZ70_07480) - 1531038..1532708 (+) 1671 WP_045926712.1 SNF2-related protein -
  AADZ70_RS07485 (AADZ70_07485) - 1532730..1533524 (+) 795 WP_016938978.1 YqhG family protein -
  AADZ70_RS07490 (AADZ70_07490) sinI 1533701..1533874 (+) 174 WP_016938977.1 anti-repressor SinI family protein Regulator
  AADZ70_RS07495 (AADZ70_07495) sinR 1533908..1534243 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AADZ70_RS07500 (AADZ70_07500) - 1534291..1535076 (-) 786 WP_047475632.1 TasA family protein -
  AADZ70_RS07505 (AADZ70_07505) - 1535140..1535724 (-) 585 WP_016938975.1 signal peptidase I -
  AADZ70_RS07510 (AADZ70_07510) tapA 1535696..1536367 (-) 672 WP_029575370.1 amyloid fiber anchoring/assembly protein TapA -
  AADZ70_RS07515 (AADZ70_07515) - 1536626..1536955 (+) 330 WP_016938972.1 DUF3889 domain-containing protein -
  AADZ70_RS07520 (AADZ70_07520) - 1536995..1537174 (-) 180 WP_016938971.1 YqzE family protein -
  AADZ70_RS07525 (AADZ70_07525) comGG 1537231..1537608 (-) 378 WP_342007946.1 competence type IV pilus minor pilin ComGG -
  AADZ70_RS07530 (AADZ70_07530) comGF 1537609..1538106 (-) 498 WP_342007947.1 competence type IV pilus minor pilin ComGF -
  AADZ70_RS07535 (AADZ70_07535) comGE 1538018..1538332 (-) 315 WP_045926718.1 competence type IV pilus minor pilin ComGE Machinery gene
  AADZ70_RS07540 (AADZ70_07540) comGD 1538316..1538753 (-) 438 WP_045926719.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6719.70 Da        Isoelectric Point: 9.8173

>NTDB_id=979679 AADZ70_RS07490 WP_016938977.1 1533701..1533874(+) (sinI) [Bacillus sp. YBsi01]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=979679 AADZ70_RS07490 WP_016938977.1 1533701..1533874(+) (sinI) [Bacillus sp. YBsi01]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTGGAAGAAATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684

Multiple sequence alignment