Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   RZR84_RS15215 Genome accession   NZ_CP151676
Coordinates   3179030..3179569 (+) Length   179 a.a.
NCBI ID   WP_142836750.1    Uniprot ID   -
Organism   Proteus mirabilis strain P3     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3144425..3185923 3179030..3179569 within 0


Gene organization within MGE regions


Location: 3144425..3185923
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RZR84_RS14960 (RZR84_14960) - 3144425..3144631 (+) 207 WP_104836668.1 DNA polymerase III subunit theta -
  RZR84_RS14965 (RZR84_14965) - 3145766..3147658 (-) 1893 WP_286452157.1 phage head-binding domain-containing protein -
  RZR84_RS14970 (RZR84_14970) - 3147772..3149802 (-) 2031 WP_142836728.1 lytic transglycosylase domain-containing protein -
  RZR84_RS14975 (RZR84_14975) - 3149802..3151247 (-) 1446 WP_142836729.1 phage DNA ejection protein -
  RZR84_RS14980 (RZR84_14980) - 3151257..3151916 (-) 660 WP_102086755.1 DNA transfer protein -
  RZR84_RS14985 (RZR84_14985) - 3151910..3152371 (-) 462 WP_142836730.1 DUF2824 family protein -
  RZR84_RS14990 (RZR84_14990) - 3152371..3153069 (-) 699 WP_142836731.1 phage tail protein -
  RZR84_RS14995 (RZR84_14995) - 3153069..3154850 (-) 1782 WP_308809872.1 packaged DNA stabilization protein -
  RZR84_RS15000 (RZR84_15000) - 3154822..3155319 (-) 498 WP_124740862.1 packaged DNA stabilization gp4 family protein -
  RZR84_RS15005 (RZR84_15005) - 3155297..3155500 (-) 204 WP_036970140.1 hypothetical protein -
  RZR84_RS15010 (RZR84_15010) - 3155552..3156835 (-) 1284 WP_063108518.1 P22 phage major capsid protein family protein -
  RZR84_RS15015 (RZR84_15015) - 3156835..3157749 (-) 915 WP_104459283.1 scaffolding protein -
  RZR84_RS15020 (RZR84_15020) - 3157764..3159854 (-) 2091 WP_142836732.1 portal protein -
  RZR84_RS15025 (RZR84_15025) - 3159857..3161176 (-) 1320 WP_232466086.1 terminase large subunit -
  RZR84_RS15030 (RZR84_15030) - 3161328..3161819 (-) 492 WP_036976889.1 DNA-packaging protein -
  RZR84_RS15035 (RZR84_15035) - 3161828..3162187 (-) 360 WP_142836733.1 hypothetical protein -
  RZR84_RS15040 (RZR84_15040) - 3162242..3162469 (-) 228 WP_142836734.1 DUF2560 family protein -
  RZR84_RS15045 (RZR84_15045) - 3162584..3162967 (-) 384 WP_142836735.1 Gp49 family protein -
  RZR84_RS15050 (RZR84_15050) - 3163068..3163259 (-) 192 WP_115370293.1 hypothetical protein -
  RZR84_RS15055 (RZR84_15055) - 3163435..3163812 (-) 378 WP_142836737.1 hypothetical protein -
  RZR84_RS15060 (RZR84_15060) - 3163809..3164201 (-) 393 WP_064497292.1 M15 family metallopeptidase -
  RZR84_RS15065 (RZR84_15065) - 3164194..3164511 (-) 318 WP_064497293.1 phage holin, lambda family -
  RZR84_RS15070 (RZR84_15070) - 3165428..3166066 (-) 639 WP_142836738.1 hypothetical protein -
  RZR84_RS15075 (RZR84_15075) - 3166063..3166281 (-) 219 WP_223231902.1 hypothetical protein -
  RZR84_RS15080 (RZR84_15080) - 3166268..3166633 (-) 366 WP_142836739.1 RusA family crossover junction endodeoxyribonuclease -
  RZR84_RS15085 (RZR84_15085) - 3166630..3166920 (-) 291 WP_063108505.1 DUF1364 domain-containing protein -
  RZR84_RS15090 (RZR84_15090) - 3167013..3167282 (-) 270 WP_142836740.1 hypothetical protein -
  RZR84_RS15095 (RZR84_15095) - 3167474..3167596 (-) 123 WP_259466354.1 hypothetical protein -
  RZR84_RS15100 (RZR84_15100) - 3167628..3167816 (-) 189 WP_213556048.1 DUF3310 domain-containing protein -
  RZR84_RS15105 (RZR84_15105) - 3167822..3168265 (-) 444 WP_121909375.1 recombination protein NinB -
  RZR84_RS15110 (RZR84_15110) - 3168675..3168968 (-) 294 WP_063073731.1 hypothetical protein -
  RZR84_RS15115 (RZR84_15115) - 3168955..3169176 (-) 222 WP_036935835.1 hypothetical protein -
  RZR84_RS15120 (RZR84_15120) - 3169192..3169359 (-) 168 WP_152964332.1 hypothetical protein -
  RZR84_RS15125 (RZR84_15125) - 3169378..3170745 (-) 1368 WP_121909389.1 replicative DNA helicase -
  RZR84_RS15130 (RZR84_15130) - 3170749..3171585 (-) 837 WP_110229454.1 replication protein -
  RZR84_RS15135 (RZR84_15135) - 3171582..3172226 (-) 645 WP_239669578.1 DNA-binding protein -
  RZR84_RS15140 (RZR84_15140) - 3172358..3172699 (-) 342 WP_036935825.1 CII family transcriptional regulator -
  RZR84_RS15145 (RZR84_15145) - 3172834..3173019 (-) 186 WP_012367616.1 Cro/CI family transcriptional regulator -
  RZR84_RS15150 (RZR84_15150) - 3173127..3173828 (+) 702 WP_012367615.1 S24 family peptidase -
  RZR84_RS15155 (RZR84_15155) - 3173859..3174164 (+) 306 WP_012367614.1 hypothetical protein -
  RZR84_RS15160 (RZR84_15160) - 3174571..3174843 (+) 273 WP_004247716.1 hypothetical protein -
  RZR84_RS15165 (RZR84_15165) - 3174858..3175094 (+) 237 WP_142836741.1 hypothetical protein -
  RZR84_RS15170 (RZR84_15170) - 3175066..3175347 (-) 282 WP_071233777.1 hypothetical protein -
  RZR84_RS15175 (RZR84_15175) - 3175516..3175788 (+) 273 WP_071233776.1 hypothetical protein -
  RZR84_RS15180 (RZR84_15180) - 3175832..3176056 (+) 225 WP_162778485.1 hypothetical protein -
  RZR84_RS15185 (RZR84_15185) - 3176128..3176283 (+) 156 WP_183129929.1 hypothetical protein -
  RZR84_RS15190 (RZR84_15190) - 3176291..3176545 (+) 255 WP_063073719.1 hypothetical protein -
  RZR84_RS15195 (RZR84_15195) - 3176542..3176763 (+) 222 WP_049199148.1 hypothetical protein -
  RZR84_RS15200 (RZR84_15200) - 3176760..3177686 (+) 927 WP_063073718.1 RecT family recombinase -
  RZR84_RS15205 (RZR84_15205) - 3177726..3178346 (+) 621 WP_142836751.1 hypothetical protein -
  RZR84_RS15210 (RZR84_15210) - 3178339..3179040 (+) 702 WP_096043072.1 lambda exonuclease family protein -
  RZR84_RS15215 (RZR84_15215) ssb 3179030..3179569 (+) 540 WP_142836750.1 single-stranded DNA-binding protein Machinery gene
  RZR84_RS15220 (RZR84_15220) - 3179585..3179746 (+) 162 WP_153274246.1 hypothetical protein -
  RZR84_RS15225 (RZR84_15225) - 3179788..3180006 (+) 219 WP_142836744.1 hypothetical protein -
  RZR84_RS15230 (RZR84_15230) - 3180042..3180329 (+) 288 WP_060558090.1 cyclic-phosphate processing receiver domain-containing protein -
  RZR84_RS15235 (RZR84_15235) - 3180329..3180682 (+) 354 WP_063073715.1 hypothetical protein -
  RZR84_RS15240 (RZR84_15240) - 3180692..3181060 (+) 369 WP_063073714.1 hypothetical protein -
  RZR84_RS15245 (RZR84_15245) - 3181208..3181375 (+) 168 WP_156868475.1 hypothetical protein -
  RZR84_RS15250 (RZR84_15250) - 3181368..3181724 (+) 357 WP_096043071.1 phage protein NinX family protein -
  RZR84_RS15255 (RZR84_15255) - 3181711..3182313 (+) 603 WP_142836745.1 MT-A70 family methyltransferase -
  RZR84_RS15260 (RZR84_15260) - 3182749..3183906 (+) 1158 WP_124740885.1 site-specific integrase -
  RZR84_RS15270 (RZR84_15270) folD 3184195..3185067 (+) 873 WP_017627899.1 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD -
  RZR84_RS15275 (RZR84_15275) ybcJ 3185071..3185283 (+) 213 WP_004244244.1 ribosome-associated protein YbcJ -

Sequence

Protein


Download         Length: 179 a.a.        Molecular weight: 19733.11 Da        Isoelectric Point: 7.2415

>NTDB_id=979645 RZR84_RS15215 WP_142836750.1 3179030..3179569(+) (ssb) [Proteus mirabilis strain P3]
MASKGVNKCILIGHLGQDPEIRYMPSGGAVANLTLATSESWRDKQTGEMKDRVEWHRVCIFGKLAEIAGEYLRKGSQVYI
EGSLQTRKWQDQSGQDRYTTEVVVNIGGTMQMLGGNGGNQAGSQKPQQNQGWGQPQQPQAPKQASSNQTPQSEPPQDWDD
PIPFAPIGLPYPRHAIYVI

Nucleotide


Download         Length: 540 bp        

>NTDB_id=979645 RZR84_RS15215 WP_142836750.1 3179030..3179569(+) (ssb) [Proteus mirabilis strain P3]
ATGGCAAGTAAAGGCGTGAATAAATGTATTCTCATTGGTCACTTGGGGCAGGATCCAGAAATCCGTTATATGCCATCAGG
TGGCGCAGTCGCTAATCTCACACTAGCCACATCGGAATCGTGGCGTGATAAGCAGACTGGTGAAATGAAGGATCGGGTTG
AGTGGCATCGAGTGTGCATCTTCGGAAAATTAGCCGAAATTGCAGGTGAATATCTGAGAAAAGGAAGTCAGGTATATATC
GAGGGCTCACTGCAAACCAGAAAATGGCAAGACCAAAGCGGTCAAGACCGATACACAACGGAAGTAGTGGTCAATATTGG
TGGAACAATGCAGATGCTAGGCGGTAACGGTGGTAATCAGGCAGGAAGCCAGAAGCCACAGCAAAACCAAGGATGGGGTC
AGCCTCAGCAACCGCAAGCGCCAAAACAAGCATCGAGTAATCAAACACCACAAAGTGAGCCACCTCAAGATTGGGATGAT
CCTATACCTTTCGCCCCTATCGGACTCCCCTACCCACGACACGCTATTTATGTGATTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-112)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

66.667

98.883

0.659
  ssb Glaesserella parasuis strain SC1401

50.829

100

0.514
  ssb Neisseria meningitidis MC58

43.182

98.324

0.425
  ssb Neisseria gonorrhoeae MS11

42.614

98.324

0.419

Multiple sequence alignment