Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   AADW22_RS08650 Genome accession   NZ_CP151529
Coordinates   1783360..1783854 (-) Length   164 a.a.
NCBI ID   WP_407473489.1    Uniprot ID   -
Organism   Sulfitobacter sp. PM12     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1778174..1820948 1783360..1783854 within 0


Gene organization within MGE regions


Location: 1778174..1820948
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AADW22_RS08590 (AADW22_08585) - 1778174..1779205 (-) 1032 WP_407473478.1 tyrosine-type recombinase/integrase -
  AADW22_RS08595 (AADW22_08590) - 1779184..1779396 (-) 213 WP_348033319.1 hypothetical protein -
  AADW22_RS08600 (AADW22_08595) - 1779393..1779551 (-) 159 WP_407473479.1 hypothetical protein -
  AADW22_RS08605 (AADW22_08600) - 1779548..1779916 (-) 369 WP_407473480.1 hypothetical protein -
  AADW22_RS08610 (AADW22_08605) - 1779909..1780394 (-) 486 WP_407473481.1 hypothetical protein -
  AADW22_RS08615 (AADW22_08610) - 1780391..1780720 (-) 330 WP_407473482.1 hypothetical protein -
  AADW22_RS08620 (AADW22_08615) - 1780717..1780962 (-) 246 WP_407473483.1 hypothetical protein -
  AADW22_RS08625 (AADW22_08620) - 1781070..1781345 (-) 276 WP_407473484.1 ASCH domain-containing protein -
  AADW22_RS08630 (AADW22_08625) - 1781411..1781959 (-) 549 WP_407473485.1 YfbR-like 5'-deoxynucleotidase -
  AADW22_RS08635 (AADW22_08630) - 1781973..1782308 (-) 336 WP_407473486.1 Ref family recombination enhancement nuclease -
  AADW22_RS08640 (AADW22_08635) - 1782305..1782730 (-) 426 WP_407473487.1 hypothetical protein -
  AADW22_RS08645 (AADW22_08640) - 1782727..1783209 (-) 483 WP_407473488.1 hypothetical protein -
  AADW22_RS08650 (AADW22_08645) ssb 1783360..1783854 (-) 495 WP_407473489.1 single-stranded DNA-binding protein Machinery gene
  AADW22_RS08655 (AADW22_08650) - 1783854..1784096 (-) 243 WP_407473490.1 DUF2312 domain-containing protein -
  AADW22_RS08660 (AADW22_08655) - 1784093..1785019 (-) 927 WP_407473491.1 ATP-binding protein -
  AADW22_RS08665 (AADW22_08660) - 1785016..1785219 (-) 204 WP_016073726.1 hypothetical protein -
  AADW22_RS08670 (AADW22_08665) - 1785417..1785704 (-) 288 WP_407473492.1 hypothetical protein -
  AADW22_RS08675 (AADW22_08670) - 1785704..1785913 (-) 210 WP_407473493.1 hypothetical protein -
  AADW22_RS08680 (AADW22_08675) - 1785910..1786086 (-) 177 WP_407473494.1 hypothetical protein -
  AADW22_RS08685 (AADW22_08680) - 1786184..1786333 (-) 150 WP_407473495.1 hypothetical protein -
  AADW22_RS08690 (AADW22_08685) - 1786572..1786907 (-) 336 WP_407473496.1 hypothetical protein -
  AADW22_RS08695 (AADW22_08690) - 1786904..1787128 (-) 225 WP_407473497.1 hypothetical protein -
  AADW22_RS08700 (AADW22_08695) - 1787125..1787322 (-) 198 WP_407473498.1 hypothetical protein -
  AADW22_RS08705 (AADW22_08700) - 1787553..1788011 (-) 459 WP_407473499.1 helix-turn-helix transcriptional regulator -
  AADW22_RS08710 (AADW22_08705) - 1788170..1788481 (+) 312 WP_407473500.1 hypothetical protein -
  AADW22_RS08715 (AADW22_08710) - 1788478..1788894 (+) 417 WP_407473501.1 RusA family crossover junction endodeoxyribonuclease -
  AADW22_RS08720 (AADW22_08715) - 1789005..1789127 (+) 123 WP_407473502.1 hypothetical protein -
  AADW22_RS08725 (AADW22_08720) - 1789124..1789303 (+) 180 WP_407473503.1 hypothetical protein -
  AADW22_RS08730 (AADW22_08725) - 1789300..1790040 (+) 741 WP_407473504.1 hypothetical protein -
  AADW22_RS08735 (AADW22_08730) - 1790040..1790357 (+) 318 WP_407473505.1 hypothetical protein -
  AADW22_RS08740 (AADW22_08735) - 1790354..1791787 (+) 1434 WP_407473506.1 bifunctional DNA primase/helicase -
  AADW22_RS08745 (AADW22_08740) - 1791784..1792254 (+) 471 WP_407473507.1 hypothetical protein -
  AADW22_RS08750 (AADW22_08745) - 1792251..1792628 (+) 378 WP_407473508.1 hypothetical protein -
  AADW22_RS08755 (AADW22_08750) - 1792625..1793419 (+) 795 WP_407473509.1 hypothetical protein -
  AADW22_RS08760 (AADW22_08755) - 1793544..1793861 (+) 318 WP_407473510.1 hypothetical protein -
  AADW22_RS08765 (AADW22_08760) - 1793851..1794204 (+) 354 WP_407473511.1 hypothetical protein -
  AADW22_RS08770 (AADW22_08765) - 1794201..1794440 (+) 240 WP_407473512.1 hypothetical protein -
  AADW22_RS08775 (AADW22_08770) - 1794622..1795242 (+) 621 WP_407473513.1 hypothetical protein -
  AADW22_RS08780 (AADW22_08775) - 1795476..1795961 (+) 486 WP_407473514.1 hypothetical protein -
  AADW22_RS08785 (AADW22_08780) - 1796304..1796495 (+) 192 WP_407473515.1 hypothetical protein -
  AADW22_RS08795 (AADW22_08790) - 1797070..1797372 (+) 303 WP_407473516.1 hypothetical protein -
  AADW22_RS08800 (AADW22_08795) - 1797356..1798600 (+) 1245 WP_407473517.1 PBSX family phage terminase large subunit -
  AADW22_RS08805 - 1798706..1799263 (+) 558 WP_407473518.1 HNH endonuclease -
  AADW22_RS08810 (AADW22_08800) - 1799311..1800618 (+) 1308 WP_407473519.1 DUF4055 domain-containing protein -
  AADW22_RS08815 (AADW22_08805) - 1800665..1801378 (+) 714 WP_407473520.1 hypothetical protein -
  AADW22_RS08820 (AADW22_08810) - 1801393..1802421 (+) 1029 WP_407473521.1 hypothetical protein -
  AADW22_RS08825 (AADW22_08815) - 1802477..1802713 (+) 237 WP_407473522.1 hypothetical protein -
  AADW22_RS08830 (AADW22_08820) - 1802715..1803110 (+) 396 WP_407473523.1 hypothetical protein -
  AADW22_RS08835 (AADW22_08825) - 1803107..1803505 (+) 399 WP_407473524.1 hypothetical protein -
  AADW22_RS08840 (AADW22_08830) - 1803683..1803808 (+) 126 WP_407473525.1 hypothetical protein -
  AADW22_RS08845 (AADW22_08835) - 1803874..1804896 (+) 1023 WP_407473526.1 phage minor head protein -
  AADW22_RS08850 (AADW22_08840) - 1804899..1805306 (+) 408 WP_407473527.1 hypothetical protein -
  AADW22_RS08855 (AADW22_08845) - 1805303..1805698 (+) 396 WP_407473528.1 phage tail terminator-like protein -
  AADW22_RS08860 (AADW22_08850) - 1805710..1805973 (+) 264 WP_335754664.1 hypothetical protein -
  AADW22_RS08865 (AADW22_08855) - 1806054..1806506 (+) 453 WP_407473529.1 hypothetical protein -
  AADW22_RS08870 (AADW22_08860) - 1806587..1807024 (+) 438 WP_407473530.1 hypothetical protein -
  AADW22_RS08875 (AADW22_08865) - 1807425..1807823 (-) 399 WP_407473531.1 hypothetical protein -
  AADW22_RS08880 (AADW22_08870) - 1807923..1811738 (+) 3816 WP_407473532.1 phage tail tape measure protein -
  AADW22_RS08885 (AADW22_08875) - 1811735..1812634 (+) 900 WP_407473533.1 hypothetical protein -
  AADW22_RS08890 (AADW22_08880) - 1812634..1813359 (+) 726 WP_407473534.1 gp53-like domain-containing protein -
  AADW22_RS08895 (AADW22_08885) - 1813362..1813625 (+) 264 WP_407473535.1 hypothetical protein -
  AADW22_RS08900 (AADW22_08890) - 1813628..1815172 (+) 1545 WP_407473536.1 hypothetical protein -
  AADW22_RS08905 (AADW22_08895) - 1815169..1815561 (+) 393 WP_407473537.1 hypothetical protein -
  AADW22_RS08910 (AADW22_08900) - 1815603..1815905 (+) 303 WP_407473538.1 DUF5658 family protein -
  AADW22_RS08915 (AADW22_08905) - 1815902..1816576 (+) 675 WP_407473539.1 lysozyme -
  AADW22_RS08920 (AADW22_08910) - 1816573..1816773 (+) 201 WP_407473540.1 hypothetical protein -
  AADW22_RS08925 (AADW22_08915) - 1816770..1816961 (+) 192 WP_407473541.1 hypothetical protein -
  AADW22_RS08930 (AADW22_08920) - 1816961..1817521 (+) 561 WP_407473542.1 hypothetical protein -
  AADW22_RS08935 (AADW22_08925) - 1817508..1817705 (+) 198 WP_339764975.1 hypothetical protein -
  AADW22_RS08940 (AADW22_08930) - 1817949..1818905 (+) 957 WP_407473543.1 hypothetical protein -
  AADW22_RS08945 (AADW22_08935) - 1819279..1819611 (-) 333 WP_407473544.1 hypothetical protein -
  AADW22_RS08950 (AADW22_08940) - 1819608..1819919 (-) 312 WP_407473545.1 hypothetical protein -
  AADW22_RS08955 (AADW22_08945) - 1819948..1820187 (-) 240 WP_407473546.1 hypothetical protein -
  AADW22_RS08960 (AADW22_08950) - 1820253..1820843 (-) 591 WP_407473547.1 hypothetical protein -

Sequence

Protein


Download         Length: 164 a.a.        Molecular weight: 17560.36 Da        Isoelectric Point: 5.3108

>NTDB_id=978968 AADW22_RS08650 WP_407473489.1 1783360..1783854(-) (ssb) [Sulfitobacter sp. PM12]
MAGSVNKVILIGNLGRDPEVRSFQNGNKVCNLRIATSETWKDRDSGERREKVEWHSVAIFQEGLVRIAEQYLKKGSKVYI
EGQLQTRKWQDQSGADKYSTEVVLQGFGGTLTMLDGNGGGSDSGGGQSGGGYDSGASGGGYGGGGRPGGRDLDDEIPFIA
EWRI

Nucleotide


Download         Length: 495 bp        

>NTDB_id=978968 AADW22_RS08650 WP_407473489.1 1783360..1783854(-) (ssb) [Sulfitobacter sp. PM12]
ATGGCTGGCAGTGTGAATAAAGTGATCCTGATCGGGAACTTGGGGCGCGATCCCGAAGTGCGCTCATTTCAGAACGGCAA
CAAGGTCTGCAACCTGCGGATTGCCACTTCCGAGACATGGAAAGACCGCGACAGCGGGGAACGCCGTGAAAAAGTTGAGT
GGCACAGCGTCGCGATTTTCCAAGAGGGCCTTGTGCGGATTGCTGAGCAGTACCTCAAGAAGGGCAGCAAGGTTTATATC
GAAGGCCAGCTTCAGACGCGCAAGTGGCAGGACCAATCCGGCGCGGACAAGTACAGCACCGAAGTTGTGCTGCAAGGCTT
CGGCGGCACCCTGACGATGCTGGACGGAAACGGTGGCGGCTCGGATAGCGGCGGCGGTCAGTCTGGCGGGGGCTATGACA
GCGGCGCGTCTGGTGGCGGGTACGGAGGGGGCGGGCGTCCAGGCGGTCGCGACCTCGACGACGAGATCCCATTCATCGCT
GAGTGGCGCATCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(5-105)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

49.432

100

0.53
  ssb Glaesserella parasuis strain SC1401

44.086

100

0.5
  ssb Neisseria gonorrhoeae MS11

41.341

100

0.451
  ssb Neisseria meningitidis MC58

40.782

100

0.445

Multiple sequence alignment