Detailed information
Bioinformatically predicted
Overview
| Name | ideA | Type | Regulator |
| Locus tag | AABD48_RS03670 | Genome accession | NZ_CP150857 |
| Coordinates | 774623..775309 (-) | Length | 228 a.a. |
| NCBI ID | WP_346330408.1 | Uniprot ID | - |
| Organism | Vibrio parahaemolyticus strain vp-201806 | ||
| Function | repress natural transformation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 719832..780518 | 774623..775309 | within | 0 |
Gene organization within MGE regions
Location: 719832..780518
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AABD48_RS03440 (AABD48_03440) | - | 719832..721073 (-) | 1242 | WP_001218618.1 | integrase family protein | - |
| AABD48_RS03445 (AABD48_03445) | - | 721075..721344 (-) | 270 | WP_001995600.1 | hypothetical protein | - |
| AABD48_RS03450 (AABD48_03450) | - | 721347..722321 (-) | 975 | WP_000497807.1 | ParM/StbA family protein | - |
| AABD48_RS03455 (AABD48_03455) | mobI | 722786..723229 (+) | 444 | WP_000348524.1 | conjugative transfer protein MobI(A/C) | - |
| AABD48_RS03460 (AABD48_03460) | umuC | 723240..724343 (-) | 1104 | WP_001910886.1 | translesion error-prone DNA polymerase V subunit UmuC | - |
| AABD48_RS03465 (AABD48_03465) | - | 724696..725289 (+) | 594 | WP_000107352.1 | Tn3 family transposase | - |
| AABD48_RS03470 (AABD48_03470) | - | 725403..728381 (+) | 2979 | WP_053020635.1 | Tn3 family transposase | - |
| AABD48_RS03475 (AABD48_03480) | - | 728799..730292 (+) | 1494 | WP_001120888.1 | IS91-like element ISVsa3 family transposase | - |
| AABD48_RS03480 (AABD48_03485) | tet(59) | 730671..731873 (-) | 1203 | WP_001031679.1 | tetracycline efflux MFS transporter Tet(59) | - |
| AABD48_RS03485 (AABD48_03490) | tetR | 731954..732556 (+) | 603 | WP_000113092.1 | tetracycline resistance transcriptional repressor TetR | - |
| AABD48_RS03490 (AABD48_03495) | - | 732735..733139 (+) | 405 | Protein_605 | IS91 family transposase | - |
| AABD48_RS03495 (AABD48_03500) | - | 733246..734082 (-) | 837 | WP_000480968.1 | aminoglycoside O-phosphotransferase APH(6)-Id | - |
| AABD48_RS03500 (AABD48_03505) | aph(3'')-Ib | 734082..734885 (-) | 804 | WP_001082319.1 | aminoglycoside O-phosphotransferase APH(3'')-Ib | - |
| AABD48_RS03505 (AABD48_03510) | sul2 | 734946..735761 (-) | 816 | WP_001043260.1 | sulfonamide-resistant dihydropteroate synthase Sul2 | - |
| AABD48_RS03510 (AABD48_03515) | - | 736232..737539 (+) | 1308 | Protein_609 | DUF4158 domain-containing protein | - |
| AABD48_RS03515 (AABD48_03520) | - | 738224..738457 (-) | 234 | Protein_610 | DNA polymerase V subunit UmuC | - |
| AABD48_RS03520 (AABD48_03525) | umuD | 738465..738914 (-) | 450 | WP_000116661.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
| AABD48_RS03525 (AABD48_03530) | - | 738913..739170 (+) | 258 | WP_000182836.1 | hypothetical protein | - |
| AABD48_RS03530 (AABD48_03535) | - | 739553..740458 (+) | 906 | WP_346330398.1 | 3'-5' exonuclease | - |
| AABD48_RS03535 (AABD48_03540) | - | 740672..740971 (+) | 300 | WP_015066542.1 | hypothetical protein | - |
| AABD48_RS03540 (AABD48_03545) | - | 741289..742224 (+) | 936 | WP_346330399.1 | WYL domain-containing protein | - |
| AABD48_RS03545 (AABD48_03550) | - | 742262..745594 (+) | 3333 | WP_023266699.1 | SNF2-related protein | - |
| AABD48_RS03550 (AABD48_03555) | - | 745598..746284 (+) | 687 | WP_024024112.1 | DUF4391 domain-containing protein | - |
| AABD48_RS03555 (AABD48_03560) | - | 746367..748313 (+) | 1947 | WP_346330400.1 | site-specific DNA-methyltransferase | - |
| AABD48_RS03560 (AABD48_03565) | - | 748323..751400 (+) | 3078 | WP_346330401.1 | DEAD/DEAH box helicase family protein | - |
| AABD48_RS03565 (AABD48_03570) | - | 751474..752328 (+) | 855 | WP_024024115.1 | restriction endonuclease | - |
| AABD48_RS03570 (AABD48_03575) | mobH | 752423..754573 (+) | 2151 | WP_119978299.1 | MobH family relaxase | - |
| AABD48_RS03575 (AABD48_03580) | traD | 754622..756442 (+) | 1821 | WP_065767335.1 | conjugative transfer system coupling protein TraD | - |
| AABD48_RS03580 (AABD48_03585) | - | 756452..757012 (+) | 561 | WP_346330402.1 | conjugative transfer protein | - |
| AABD48_RS03585 (AABD48_03590) | - | 756999..757634 (+) | 636 | WP_000033753.1 | DUF4400 domain-containing protein | - |
| AABD48_RS03590 (AABD48_03595) | - | 757661..758248 (-) | 588 | Protein_625 | plasmid-related protein | - |
| AABD48_RS03595 (AABD48_03600) | traL | 758536..758817 (+) | 282 | WP_346330403.1 | type IV conjugative transfer system protein TraL | - |
| AABD48_RS03600 (AABD48_03605) | - | 758814..759440 (+) | 627 | WP_000667170.1 | TraE/TraK family type IV conjugative transfer system protein | - |
| AABD48_RS03605 (AABD48_03610) | - | 759424..760320 (+) | 897 | WP_346330423.1 | type-F conjugative transfer system secretin TraK | - |
| AABD48_RS03610 (AABD48_03615) | - | 760323..761612 (+) | 1290 | WP_346330404.1 | TraB/VirB10 family protein | - |
| AABD48_RS03615 (AABD48_03620) | traV | 761687..762259 (+) | 573 | WP_023266686.1 | type IV conjugative transfer system lipoprotein TraV | - |
| AABD48_RS03620 (AABD48_03625) | traA | 762256..762630 (+) | 375 | WP_023266685.1 | TraA family conjugative transfer protein | - |
| AABD48_RS03625 (AABD48_03630) | - | 762706..763434 (+) | 729 | WP_065767329.1 | hypothetical protein | - |
| AABD48_RS03630 (AABD48_03635) | - | 763622..764314 (+) | 693 | WP_001228924.1 | DsbC family protein | - |
| AABD48_RS03635 (AABD48_03640) | traC | 764314..766713 (+) | 2400 | WP_024008831.1 | type IV secretion system protein TraC | - |
| AABD48_RS03640 (AABD48_03645) | - | 766706..767053 (+) | 348 | WP_015066569.1 | hypothetical protein | - |
| AABD48_RS03645 (AABD48_03650) | - | 767037..767549 (+) | 513 | WP_174234192.1 | S26 family signal peptidase | - |
| AABD48_RS03650 (AABD48_03655) | - | 767560..768684 (+) | 1125 | WP_118119248.1 | TrbC family F-type conjugative pilus assembly protein | - |
| AABD48_RS03655 (AABD48_03660) | - | 768668..769696 (+) | 1029 | WP_346330405.1 | TraU family protein | - |
| AABD48_RS03660 (AABD48_03665) | traN | 769699..773391 (+) | 3693 | WP_346330406.1 | conjugal transfer protein TraN | - |
| AABD48_RS03665 (AABD48_03670) | - | 773474..774571 (-) | 1098 | WP_346330407.1 | hypothetical protein | - |
| AABD48_RS03670 (AABD48_03675) | ideA | 774623..775309 (-) | 687 | WP_346330408.1 | endonuclease | Regulator |
| AABD48_RS03675 (AABD48_03680) | - | 775418..776020 (-) | 603 | WP_000035786.1 | hypothetical protein | - |
| AABD48_RS03680 (AABD48_03685) | - | 776388..776714 (+) | 327 | WP_000455722.1 | hypothetical protein | - |
| AABD48_RS03685 (AABD48_03690) | ssb | 776730..777149 (+) | 420 | WP_000795984.1 | single-stranded DNA-binding protein | - |
| AABD48_RS03690 (AABD48_03695) | bet | 777229..778047 (+) | 819 | WP_000414663.1 | phage recombination protein Bet | - |
| AABD48_RS03695 (AABD48_03700) | - | 778129..778272 (+) | 144 | WP_000167276.1 | hypothetical protein | - |
| AABD48_RS03700 (AABD48_03705) | - | 778333..779349 (+) | 1017 | WP_000862954.1 | lambda-exonuclease family protein | - |
| AABD48_RS03705 (AABD48_03710) | - | 779559..780518 (+) | 960 | WP_000139694.1 | AAA family ATPase | - |
Sequence
Protein
Download Length: 228 a.a. Molecular weight: 26482.59 Da Isoelectric Point: 7.5668
>NTDB_id=973086 AABD48_RS03670 WP_346330408.1 774623..775309(-) (ideA) [Vibrio parahaemolyticus strain vp-201806]
MNRTNFLVTFLIALFAIPAFAEHPTSFSQAKRFAREIYQDNQSTFYCGCSYNNNGAIDAASCGYEPRKQPKRGERLEWEH
VVSAWEIGHQRQCWQNGGRRNCEKNDPEFSKMVSDLHNLVPSVGELNGDRSNFRFGMIPNEPRAYGLCDFEVDFKDRRAE
PPANRQGDIARIYFYMRDQYGLRLSRQQTQLFEAWSRMDPVDEWEKVRDLKIKSIQGNSNCHVSNSCS
MNRTNFLVTFLIALFAIPAFAEHPTSFSQAKRFAREIYQDNQSTFYCGCSYNNNGAIDAASCGYEPRKQPKRGERLEWEH
VVSAWEIGHQRQCWQNGGRRNCEKNDPEFSKMVSDLHNLVPSVGELNGDRSNFRFGMIPNEPRAYGLCDFEVDFKDRRAE
PPANRQGDIARIYFYMRDQYGLRLSRQQTQLFEAWSRMDPVDEWEKVRDLKIKSIQGNSNCHVSNSCS
Nucleotide
Download Length: 687 bp
>NTDB_id=973086 AABD48_RS03670 WP_346330408.1 774623..775309(-) (ideA) [Vibrio parahaemolyticus strain vp-201806]
ATGAATAGAACTAATTTTCTCGTTACCTTCTTAATAGCGTTGTTCGCTATCCCTGCATTTGCAGAACACCCAACATCGTT
CAGCCAGGCAAAACGATTTGCCCGAGAAATTTACCAAGACAACCAGAGTACGTTTTACTGTGGATGTAGCTATAACAATA
ATGGTGCGATTGATGCTGCATCTTGCGGATATGAACCAAGGAAGCAACCGAAACGAGGAGAACGCTTAGAGTGGGAGCAC
GTTGTCTCAGCTTGGGAAATTGGCCATCAACGCCAATGCTGGCAAAATGGTGGTCGTCGGAACTGTGAAAAGAATGATCC
TGAGTTTTCTAAAATGGTGTCGGATCTCCATAACCTTGTACCATCTGTAGGAGAACTCAATGGGGATAGATCAAATTTTC
GATTTGGCATGATTCCGAATGAACCAAGAGCCTATGGTCTATGTGATTTCGAAGTTGATTTCAAAGACCGTCGAGCAGAA
CCACCAGCTAACCGTCAGGGTGATATTGCTAGAATTTATTTCTACATGCGAGATCAATACGGCCTAAGACTAAGCAGGCA
ACAAACTCAGCTTTTTGAAGCTTGGTCAAGAATGGACCCTGTTGACGAATGGGAAAAAGTACGTGATTTGAAGATTAAAA
GTATTCAAGGTAATTCAAATTGCCATGTGAGTAATAGTTGCAGCTGA
ATGAATAGAACTAATTTTCTCGTTACCTTCTTAATAGCGTTGTTCGCTATCCCTGCATTTGCAGAACACCCAACATCGTT
CAGCCAGGCAAAACGATTTGCCCGAGAAATTTACCAAGACAACCAGAGTACGTTTTACTGTGGATGTAGCTATAACAATA
ATGGTGCGATTGATGCTGCATCTTGCGGATATGAACCAAGGAAGCAACCGAAACGAGGAGAACGCTTAGAGTGGGAGCAC
GTTGTCTCAGCTTGGGAAATTGGCCATCAACGCCAATGCTGGCAAAATGGTGGTCGTCGGAACTGTGAAAAGAATGATCC
TGAGTTTTCTAAAATGGTGTCGGATCTCCATAACCTTGTACCATCTGTAGGAGAACTCAATGGGGATAGATCAAATTTTC
GATTTGGCATGATTCCGAATGAACCAAGAGCCTATGGTCTATGTGATTTCGAAGTTGATTTCAAAGACCGTCGAGCAGAA
CCACCAGCTAACCGTCAGGGTGATATTGCTAGAATTTATTTCTACATGCGAGATCAATACGGCCTAAGACTAAGCAGGCA
ACAAACTCAGCTTTTTGAAGCTTGGTCAAGAATGGACCCTGTTGACGAATGGGAAAAAGTACGTGATTTGAAGATTAAAA
GTATTCAAGGTAATTCAAATTGCCATGTGAGTAATAGTTGCAGCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ideA | Vibrio cholerae O1 str. 2010EL-1786 |
95.595 |
99.561 |
0.952 |
| dns | Vibrio parahaemolyticus RIMD 2210633 |
52.402 |
100 |
0.526 |
| dns | Aliivibrio fischeri ES114 |
52.174 |
100 |
0.526 |
| dns | Vibrio cholerae strain A1552 |
51.556 |
98.684 |
0.509 |
| dns | Campylobacter jejuni RM1221 |
38.605 |
94.298 |
0.364 |