Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | WOC59_RS09140 | Genome accession | NZ_CP150769 |
| Coordinates | 1794949..1795419 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934770.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain TUM20915 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1764721..1823888 | 1794949..1795419 | within | 0 |
Gene organization within MGE regions
Location: 1764721..1823888
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WOC59_RS08925 (WOC59_08905) | scn | 1764721..1765071 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| WOC59_RS08930 (WOC59_08910) | - | 1765582..1765920 (-) | 339 | Protein_1719 | SH3 domain-containing protein | - |
| WOC59_RS08935 (WOC59_08915) | sak | 1766568..1767059 (-) | 492 | WP_000920038.1 | staphylokinase | - |
| WOC59_RS08940 (WOC59_08920) | - | 1767250..1768005 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| WOC59_RS08945 (WOC59_08925) | - | 1768017..1768271 (-) | 255 | WP_000611512.1 | phage holin | - |
| WOC59_RS08950 (WOC59_08930) | - | 1768323..1768430 (+) | 108 | WP_031762631.1 | hypothetical protein | - |
| WOC59_RS08955 (WOC59_08935) | pepG1 | 1768483..1768617 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| WOC59_RS08960 (WOC59_08940) | - | 1768809..1769105 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| WOC59_RS08965 (WOC59_08945) | - | 1769163..1769450 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| WOC59_RS08970 (WOC59_08950) | - | 1769497..1769649 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| WOC59_RS08975 (WOC59_08955) | - | 1769639..1773424 (-) | 3786 | WP_000582158.1 | phage tail spike protein | - |
| WOC59_RS08980 (WOC59_08960) | - | 1773440..1774924 (-) | 1485 | WP_368410571.1 | phage distal tail protein | - |
| WOC59_RS08985 (WOC59_08965) | - | 1774921..1779450 (-) | 4530 | WP_001795393.1 | phage tail tape measure protein | - |
| WOC59_RS08990 (WOC59_08970) | gpGT | 1779507..1779644 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| WOC59_RS08995 (WOC59_08975) | gpG | 1779695..1780045 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| WOC59_RS09000 (WOC59_08980) | - | 1780095..1780319 (-) | 225 | WP_398572681.1 | Ig-like domain-containing protein | - |
| WOC59_RS09005 (WOC59_08985) | - | 1780361..1781005 (-) | 645 | WP_000268741.1 | major tail protein | - |
| WOC59_RS09010 (WOC59_08990) | - | 1781006..1781413 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| WOC59_RS09015 (WOC59_08995) | - | 1781410..1781814 (-) | 405 | WP_000114225.1 | HK97 gp10 family phage protein | - |
| WOC59_RS09020 (WOC59_09000) | - | 1781811..1782173 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| WOC59_RS09025 (WOC59_09005) | - | 1782157..1782441 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| WOC59_RS09030 (WOC59_09010) | - | 1782431..1782715 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| WOC59_RS09035 (WOC59_09015) | - | 1782735..1783880 (-) | 1146 | WP_000154555.1 | phage major capsid protein | - |
| WOC59_RS09040 (WOC59_09020) | - | 1783904..1784641 (-) | 738 | WP_000861914.1 | head maturation protease, ClpP-related | - |
| WOC59_RS09045 (WOC59_09025) | - | 1784625..1785812 (-) | 1188 | WP_261921432.1 | phage portal protein | - |
| WOC59_RS09050 (WOC59_09030) | - | 1785828..1787489 (-) | 1662 | WP_368410570.1 | terminase large subunit domain-containing protein | - |
| WOC59_RS09055 (WOC59_09035) | - | 1787486..1787830 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| WOC59_RS09060 (WOC59_09040) | - | 1787960..1788259 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| WOC59_RS09065 (WOC59_09045) | - | 1788491..1788907 (-) | 417 | WP_000590126.1 | hypothetical protein | - |
| WOC59_RS09070 (WOC59_09050) | - | 1788935..1789135 (-) | 201 | WP_000265041.1 | DUF1514 family protein | - |
| WOC59_RS09075 (WOC59_09055) | - | 1789135..1789785 (-) | 651 | WP_001005262.1 | hypothetical protein | - |
| WOC59_RS09080 (WOC59_09060) | rinB | 1789944..1790093 (-) | 150 | WP_000595267.1 | transcriptional activator RinB | - |
| WOC59_RS09085 (WOC59_09065) | - | 1790090..1790296 (-) | 207 | WP_000195810.1 | DUF1381 domain-containing protein | - |
| WOC59_RS09090 (WOC59_09070) | - | 1790333..1790869 (-) | 537 | WP_001066444.1 | dUTPase | - |
| WOC59_RS09095 (WOC59_09075) | - | 1791225..1791350 (-) | 126 | Protein_1752 | DUF1024 family protein | - |
| WOC59_RS09100 (WOC59_09080) | - | 1791343..1791753 (-) | 411 | WP_000197968.1 | hypothetical protein | - |
| WOC59_RS09105 (WOC59_09085) | - | 1791750..1792259 (-) | 510 | WP_001105598.1 | hypothetical protein | - |
| WOC59_RS09110 (WOC59_09090) | - | 1792256..1792705 (-) | 450 | WP_000982711.1 | YopX family protein | - |
| WOC59_RS09115 (WOC59_09095) | - | 1792770..1793012 (-) | 243 | WP_000131366.1 | SAV1978 family virulence-associated passenger protein | - |
| WOC59_RS09120 (WOC59_09100) | - | 1793016..1793384 (-) | 369 | WP_000101274.1 | SA1788 family PVL leukocidin-associated protein | - |
| WOC59_RS09125 (WOC59_09105) | - | 1793397..1793801 (-) | 405 | WP_000401969.1 | RusA family crossover junction endodeoxyribonuclease | - |
| WOC59_RS09130 (WOC59_09110) | - | 1793810..1794028 (-) | 219 | WP_000338528.1 | hypothetical protein | - |
| WOC59_RS09135 (WOC59_09115) | - | 1794035..1794919 (-) | 885 | WP_000148301.1 | DnaD domain protein | - |
| WOC59_RS09140 (WOC59_09120) | ssbA | 1794949..1795419 (-) | 471 | WP_000934770.1 | single-stranded DNA-binding protein | Machinery gene |
| WOC59_RS09145 (WOC59_09125) | - | 1795420..1796037 (-) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| WOC59_RS09150 (WOC59_09130) | - | 1796118..1797038 (-) | 921 | WP_000138481.1 | recombinase RecT | - |
| WOC59_RS09155 (WOC59_09135) | - | 1797040..1798983 (-) | 1944 | WP_000700562.1 | AAA family ATPase | - |
| WOC59_RS09160 (WOC59_09140) | - | 1798992..1799255 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| WOC59_RS09165 (WOC59_09145) | - | 1799264..1799524 (-) | 261 | WP_000291489.1 | DUF1108 family protein | - |
| WOC59_RS09170 (WOC59_09150) | - | 1799617..1799778 (-) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| WOC59_RS09175 (WOC59_09155) | - | 1799775..1800095 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| WOC59_RS09180 (WOC59_09160) | - | 1800154..1800786 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| WOC59_RS09185 (WOC59_09165) | - | 1800801..1800941 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| WOC59_RS09190 (WOC59_09170) | - | 1800972..1801169 (-) | 198 | WP_001148861.1 | hypothetical protein | - |
| WOC59_RS09195 (WOC59_09175) | - | 1801185..1801940 (-) | 756 | WP_001148341.1 | phage antirepressor KilAC domain-containing protein | - |
| WOC59_RS09200 (WOC59_09180) | - | 1801997..1802536 (+) | 540 | WP_000351243.1 | hypothetical protein | - |
| WOC59_RS09205 (WOC59_09185) | - | 1802560..1802820 (-) | 261 | WP_000435341.1 | transcriptional regulator | - |
| WOC59_RS09210 (WOC59_09190) | - | 1802834..1803076 (-) | 243 | WP_000639927.1 | DUF739 family protein | - |
| WOC59_RS09215 (WOC59_09195) | - | 1803240..1803956 (+) | 717 | WP_001083967.1 | LexA family transcriptional regulator | - |
| WOC59_RS09220 (WOC59_09200) | - | 1803968..1804825 (+) | 858 | WP_000804507.1 | HIRAN domain-containing protein | - |
| WOC59_RS09225 (WOC59_09205) | - | 1804870..1805052 (+) | 183 | WP_000705248.1 | hypothetical protein | - |
| WOC59_RS09230 (WOC59_09210) | - | 1805151..1805615 (+) | 465 | WP_000825947.1 | hypothetical protein | - |
| WOC59_RS09235 (WOC59_09215) | - | 1805674..1806711 (+) | 1038 | WP_000857191.1 | site-specific integrase | - |
| WOC59_RS09240 (WOC59_09220) | sph | 1806768..1807592 (+) | 825 | Protein_1781 | sphingomyelin phosphodiesterase | - |
| WOC59_RS09245 (WOC59_09225) | lukG | 1807830..1808846 (-) | 1017 | WP_000595401.1 | bi-component leukocidin LukGH subunit G | - |
| WOC59_RS09250 (WOC59_09230) | lukH | 1808868..1809920 (-) | 1053 | WP_000791417.1 | bi-component leukocidin LukGH subunit H | - |
| WOC59_RS09255 (WOC59_09235) | - | 1810356..1811579 (+) | 1224 | WP_000206623.1 | ArgE/DapE family deacylase | - |
| WOC59_RS09260 (WOC59_09240) | - | 1811951..1812796 (-) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
| WOC59_RS09265 (WOC59_09245) | - | 1812858..1813769 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| WOC59_RS09270 (WOC59_09250) | - | 1813930..1815237 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| WOC59_RS09275 (WOC59_09255) | - | 1816082..1816525 (-) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| WOC59_RS09280 (WOC59_09260) | - | 1816631..1817068 (-) | 438 | WP_072419900.1 | hypothetical protein | - |
| WOC59_RS09285 (WOC59_09265) | - | 1817385..1817975 (-) | 591 | WP_001293059.1 | terminase small subunit | - |
| WOC59_RS09290 (WOC59_09270) | - | 1817972..1818184 (-) | 213 | WP_000128898.1 | LuxR C-terminal-related transcriptional regulator | - |
| WOC59_RS09295 (WOC59_09275) | - | 1818245..1818791 (+) | 547 | Protein_1792 | site-specific integrase | - |
| WOC59_RS09300 (WOC59_09280) | groL | 1818886..1820502 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| WOC59_RS09305 (WOC59_09285) | groES | 1820578..1820862 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| WOC59_RS09310 (WOC59_09290) | mroQ | 1821037..1821780 (+) | 744 | WP_000197635.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| WOC59_RS09315 (WOC59_09295) | - | 1821806..1823065 (-) | 1260 | WP_000120305.1 | SdrH family protein | - |
| WOC59_RS09320 (WOC59_09300) | - | 1823262..1823888 (+) | 627 | WP_000522384.1 | nitroreductase family protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17713.63 Da Isoelectric Point: 5.2672
>NTDB_id=972280 WOC59_RS09140 WP_000934770.1 1794949..1795419(-) (ssbA) [Staphylococcus aureus strain TUM20915]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=972280 WOC59_RS09140 WP_000934770.1 1794949..1795419(-) (ssbA) [Staphylococcus aureus strain TUM20915]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |