Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   UXR45_RS08580 Genome accession   NZ_CP150657
Coordinates   1679710..1680180 (+) Length   156 a.a.
NCBI ID   WP_000934769.1    Uniprot ID   -
Organism   Staphylococcus aureus strain BSN214     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1670076..1713241 1679710..1680180 within 0


Gene organization within MGE regions


Location: 1670076..1713241
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  UXR45_RS08500 (UXR45_08500) - 1670076..1671122 (-) 1047 WP_001145722.1 tyrosine-type recombinase/integrase -
  UXR45_RS08505 (UXR45_08505) - 1671332..1672012 (-) 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
  UXR45_RS08510 (UXR45_08510) - 1672152..1672319 (-) 168 WP_000705238.1 hypothetical protein -
  UXR45_RS08515 (UXR45_08515) - 1672389..1673108 (-) 720 WP_048519646.1 XRE family transcriptional regulator -
  UXR45_RS08520 (UXR45_08520) - 1673250..1673468 (+) 219 WP_001198673.1 helix-turn-helix transcriptional regulator -
  UXR45_RS08525 (UXR45_08525) - 1673484..1673654 (+) 171 WP_000398751.1 hypothetical protein -
  UXR45_RS08530 (UXR45_08530) - 1673643..1673852 (-) 210 WP_000033736.1 hypothetical protein -
  UXR45_RS08535 (UXR45_08535) - 1673909..1674658 (+) 750 WP_001148588.1 phage antirepressor KilAC domain-containing protein -
  UXR45_RS08540 (UXR45_08540) - 1674674..1675123 (+) 450 WP_048519647.1 hypothetical protein -
  UXR45_RS08545 (UXR45_08545) - 1675137..1675358 (+) 222 WP_000977377.1 hypothetical protein -
  UXR45_RS08550 (UXR45_08550) - 1675351..1675512 (+) 162 WP_000048124.1 DUF1270 family protein -
  UXR45_RS08555 (UXR45_08555) - 1675605..1675865 (+) 261 WP_000291489.1 DUF1108 family protein -
  UXR45_RS08560 (UXR45_08560) - 1675874..1676137 (+) 264 WP_001205732.1 hypothetical protein -
  UXR45_RS08565 (UXR45_08565) - 1676146..1678089 (+) 1944 WP_000700565.1 AAA family ATPase -
  UXR45_RS08570 (UXR45_08570) - 1678091..1679011 (+) 921 WP_000138475.1 recombinase RecT -
  UXR45_RS08575 (UXR45_08575) - 1679092..1679709 (+) 618 WP_071621397.1 MBL fold metallo-hydrolase -
  UXR45_RS08580 (UXR45_08580) ssbA 1679710..1680180 (+) 471 WP_000934769.1 single-stranded DNA-binding protein Machinery gene
  UXR45_RS08585 (UXR45_08585) - 1680210..1681094 (+) 885 WP_000148298.1 DnaD domain protein -
  UXR45_RS08590 (UXR45_08590) - 1681101..1681319 (+) 219 WP_000338528.1 hypothetical protein -
  UXR45_RS08595 (UXR45_08595) - 1681328..1681732 (+) 405 WP_000401964.1 RusA family crossover junction endodeoxyribonuclease -
  UXR45_RS08600 (UXR45_08600) - 1681745..1682011 (+) 267 Protein_1678 SA1788 family PVL leukocidin-associated protein -
  UXR45_RS08605 (UXR45_08605) - 1682020..1682262 (+) 243 WP_048519661.1 SAV1978 family virulence-associated passenger protein -
  UXR45_RS08610 (UXR45_08610) - 1682277..1682525 (+) 249 WP_048519662.1 DUF1024 family protein -
  UXR45_RS08615 (UXR45_08615) - 1682518..1683051 (+) 534 WP_048519663.1 dUTP pyrophosphatase -
  UXR45_RS08620 (UXR45_08620) - 1683088..1683333 (+) 246 WP_031905177.1 hypothetical protein -
  UXR45_RS08625 (UXR45_08625) - 1683502..1683651 (+) 150 WP_031926954.1 DUF1381 domain-containing protein -
  UXR45_RS08630 (UXR45_08630) - 1683644..1684102 (+) 459 WP_048519664.1 hypothetical protein -
  UXR45_RS08635 (UXR45_08635) - 1684115..1684288 (+) 174 WP_048519665.1 transcriptional activator RinB -
  UXR45_RS08640 (UXR45_08640) - 1684289..1684435 (+) 147 WP_000989998.1 hypothetical protein -
  UXR45_RS08645 (UXR45_08645) - 1684459..1684881 (+) 423 WP_000162699.1 RinA family phage transcriptional activator -
  UXR45_RS08650 (UXR45_08650) - 1685068..1685508 (+) 441 WP_001003272.1 terminase small subunit -
  UXR45_RS08655 (UXR45_08655) - 1685495..1686772 (+) 1278 WP_000169944.1 PBSX family phage terminase large subunit -
  UXR45_RS08660 (UXR45_08660) - 1686783..1688318 (+) 1536 WP_048519666.1 phage portal protein -
  UXR45_RS08665 (UXR45_08665) - 1688325..1689320 (+) 996 WP_048519667.1 minor capsid protein -
  UXR45_RS08670 (UXR45_08670) - 1689393..1689563 (+) 171 WP_000072208.1 hypothetical protein -
  UXR45_RS08675 (UXR45_08675) - 1689591..1689684 (+) 94 Protein_1693 hypothetical protein -
  UXR45_RS08680 (UXR45_08680) - 1689672..1690292 (+) 621 WP_000392146.1 DUF4355 domain-containing protein -
  UXR45_RS08685 (UXR45_08685) - 1690306..1691280 (+) 975 WP_048519668.1 phage major capsid protein -
  UXR45_RS08690 (UXR45_08690) - 1691302..1691589 (+) 288 WP_001114085.1 hypothetical protein -
  UXR45_RS08695 (UXR45_08695) - 1691598..1691930 (+) 333 WP_000208959.1 phage head-tail connector protein -
  UXR45_RS08700 (UXR45_08700) - 1691927..1692229 (+) 303 WP_001268304.1 hypothetical protein -
  UXR45_RS08705 (UXR45_08705) - 1692229..1692576 (+) 348 WP_001017811.1 HK97-gp10 family putative phage morphogenesis protein -
  UXR45_RS08710 (UXR45_08710) - 1692588..1692971 (+) 384 WP_048519669.1 hypothetical protein -
  UXR45_RS08715 (UXR45_08715) - 1692990..1693571 (+) 582 WP_000002583.1 phage major tail protein, TP901-1 family -
  UXR45_RS08720 (UXR45_08720) - 1693633..1693998 (+) 366 WP_001100163.1 tail assembly chaperone -
  UXR45_RS08725 (UXR45_08725) - 1694028..1694372 (+) 345 WP_000105584.1 hypothetical protein -
  UXR45_RS08730 (UXR45_08730) - 1694389..1697853 (+) 3465 WP_048519670.1 membrane protein -
  UXR45_RS08735 (UXR45_08735) - 1697866..1698813 (+) 948 WP_001557971.1 phage tail family protein -
  UXR45_RS08740 (UXR45_08740) - 1698822..1700723 (+) 1902 WP_000152714.1 SGNH/GDSL hydrolase family protein -
  UXR45_RS08745 (UXR45_08745) - 1700738..1702648 (+) 1911 WP_048519671.1 hypothetical protein -
  UXR45_RS08750 (UXR45_08750) - 1702648..1704471 (+) 1824 WP_000259600.1 BppU family phage baseplate upper protein -
  UXR45_RS08755 (UXR45_08755) - 1704471..1704848 (+) 378 WP_000705888.1 DUF2977 domain-containing protein -
  UXR45_RS08760 (UXR45_08760) - 1704858..1705031 (+) 174 WP_001800921.1 XkdX family protein -
  UXR45_RS08765 (UXR45_08765) - 1705072..1705371 (+) 300 WP_000466784.1 DUF2951 domain-containing protein -
  UXR45_RS08770 (UXR45_08770) - 1705508..1707412 (+) 1905 WP_048519672.1 glucosaminidase domain-containing protein -
  UXR45_RS08775 (UXR45_08775) - 1707425..1708597 (+) 1173 WP_000276624.1 BppU family phage baseplate upper protein -
  UXR45_RS08780 (UXR45_08780) - 1708603..1708998 (+) 396 WP_000398882.1 hypothetical protein -
  UXR45_RS08785 (UXR45_08785) - 1709054..1709491 (+) 438 WP_000354135.1 phage holin -
  UXR45_RS08790 (UXR45_08790) - 1709472..1710917 (+) 1446 WP_048519673.1 SH3 domain-containing protein -
  UXR45_RS08795 (UXR45_08795) - 1711160..1711312 (+) 153 WP_001788502.1 hypothetical protein -
  UXR45_RS08800 (UXR45_08800) - 1711383..1711493 (+) 111 WP_000139423.1 hypothetical protein -
  UXR45_RS08805 (UXR45_08805) - 1711495..1711680 (+) 186 WP_001286805.1 hypothetical protein -
  UXR45_RS08810 (UXR45_08810) - 1712006..1712107 (-) 102 WP_011447034.1 hypothetical protein -
  UXR45_RS08815 (UXR45_08815) - 1712434..1712595 (+) 162 WP_001005407.1 SE1561 family protein -
  UXR45_RS08820 (UXR45_08820) - 1712726..1713241 (+) 516 WP_000163283.1 type 1 glutamine amidotransferase domain-containing protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17671.55 Da        Isoelectric Point: 5.2672

>NTDB_id=971009 UXR45_RS08580 WP_000934769.1 1679710..1680180(+) (ssbA) [Staphylococcus aureus strain BSN214]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=971009 UXR45_RS08580 WP_000934769.1 1679710..1680180(+) (ssbA) [Staphylococcus aureus strain BSN214]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment