Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   WMR86_RS15015 Genome accession   NZ_CP150645
Coordinates   3173161..3173658 (+) Length   165 a.a.
NCBI ID   WP_100160156.1    Uniprot ID   -
Organism   Proteus vulgaris strain HJ90     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3132845..3175203 3173161..3173658 within 0


Gene organization within MGE regions


Location: 3132845..3175203
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WMR86_RS14770 (WMR86_14770) - 3132845..3134131 (+) 1287 WP_277273653.1 SIR2 family protein -
  WMR86_RS14775 (WMR86_14775) - 3134134..3135864 (+) 1731 WP_112860379.1 ATP-binding protein -
  WMR86_RS14780 (WMR86_14780) - 3135917..3137125 (-) 1209 WP_277273652.1 integrase arm-type DNA-binding domain-containing protein -
  WMR86_RS14785 (WMR86_14785) - 3137532..3138758 (+) 1227 WP_340893596.1 site-specific integrase -
  WMR86_RS14790 (WMR86_14790) - 3139117..3139281 (+) 165 WP_228407138.1 DNA polymerase III subunit theta -
  WMR86_RS14795 (WMR86_14795) - 3139365..3139778 (-) 414 WP_161737893.1 hypothetical protein -
  WMR86_RS14800 (WMR86_14800) - 3139833..3141182 (-) 1350 WP_340893597.1 hypothetical protein -
  WMR86_RS14805 (WMR86_14805) - 3141204..3144653 (-) 3450 WP_340893598.1 DUF1983 domain-containing protein -
  WMR86_RS14810 (WMR86_14810) - 3144654..3145052 (-) 399 WP_161706129.1 hypothetical protein -
  WMR86_RS14815 (WMR86_14815) - 3145108..3145383 (-) 276 WP_340893600.1 hypothetical protein -
  WMR86_RS14820 (WMR86_14820) - 3145397..3145978 (-) 582 WP_340893602.1 hypothetical protein -
  WMR86_RS14825 (WMR86_14825) - 3145975..3146574 (-) 600 WP_075674150.1 hypothetical protein -
  WMR86_RS14830 (WMR86_14830) - 3146575..3149886 (-) 3312 WP_340893603.1 phage tail tape measure protein -
  WMR86_RS14835 (WMR86_14835) - 3150145..3150495 (-) 351 WP_036904969.1 phage tail protein -
  WMR86_RS14840 (WMR86_14840) - 3150495..3150968 (-) 474 WP_340893604.1 phage tail protein -
  WMR86_RS14845 (WMR86_14845) - 3150980..3151381 (-) 402 WP_340896708.1 HK97-gp10 family putative phage morphogenesis protein -
  WMR86_RS14850 (WMR86_14850) - 3151381..3151770 (-) 390 WP_340893605.1 hypothetical protein -
  WMR86_RS14855 (WMR86_14855) - 3151757..3152083 (-) 327 WP_340893606.1 phage head closure protein -
  WMR86_RS14860 (WMR86_14860) - 3152090..3152392 (-) 303 WP_071425267.1 head-tail connector protein -
  WMR86_RS14865 (WMR86_14865) - 3152485..3153693 (-) 1209 WP_340893607.1 phage major capsid protein -
  WMR86_RS14870 (WMR86_14870) - 3153707..3154351 (-) 645 WP_170832166.1 HK97 family phage prohead protease -
  WMR86_RS14875 (WMR86_14875) - 3154329..3155558 (-) 1230 WP_340893608.1 phage portal protein -
  WMR86_RS14880 (WMR86_14880) - 3155558..3155737 (-) 180 WP_109372933.1 hypothetical protein -
  WMR86_RS14885 (WMR86_14885) - 3155747..3157480 (-) 1734 WP_340893610.1 terminase TerL endonuclease subunit -
  WMR86_RS14890 (WMR86_14890) - 3157484..3157954 (-) 471 WP_099660116.1 phage terminase small subunit P27 family -
  WMR86_RS14895 (WMR86_14895) - 3158168..3158515 (-) 348 WP_340893612.1 HNH endonuclease -
  WMR86_RS14900 (WMR86_14900) - 3158574..3158885 (-) 312 WP_285805644.1 hypothetical protein -
  WMR86_RS14905 (WMR86_14905) - 3159078..3160166 (+) 1089 WP_340893613.1 DUF2971 domain-containing protein -
  WMR86_RS14910 (WMR86_14910) - 3160380..3160844 (-) 465 WP_340893614.1 lysis protein -
  WMR86_RS14915 (WMR86_14915) - 3160841..3161233 (-) 393 WP_340893616.1 M15 family metallopeptidase -
  WMR86_RS14920 (WMR86_14920) - 3161226..3161537 (-) 312 WP_340893617.1 phage holin family protein -
  WMR86_RS14925 (WMR86_14925) - 3161702..3162658 (-) 957 WP_098943293.1 hypothetical protein -
  WMR86_RS14930 (WMR86_14930) - 3162763..3163419 (-) 657 WP_340893618.1 bacteriophage antitermination protein Q -
  WMR86_RS14935 (WMR86_14935) - 3163447..3164472 (-) 1026 WP_340893619.1 DUF968 domain-containing protein -
  WMR86_RS14940 (WMR86_14940) - 3164469..3164603 (-) 135 Protein_2899 KilA-N domain-containing protein -
  WMR86_RS14945 (WMR86_14945) - 3164688..3165074 (-) 387 WP_100159840.1 RusA family crossover junction endodeoxyribonuclease -
  WMR86_RS14950 (WMR86_14950) - 3165137..3165247 (-) 111 Protein_2901 HNH endonuclease -
  WMR86_RS14955 (WMR86_14955) - 3165248..3166729 (-) 1482 WP_340893621.1 phage N-6-adenine-methyltransferase -
  WMR86_RS14960 (WMR86_14960) - 3166729..3167820 (-) 1092 WP_340893622.1 replication protein -
  WMR86_RS14965 (WMR86_14965) - 3167833..3168012 (-) 180 WP_099659597.1 DUF4222 domain-containing protein -
  WMR86_RS14970 (WMR86_14970) - 3168002..3168211 (-) 210 WP_098943307.1 hypothetical protein -
  WMR86_RS14975 (WMR86_14975) - 3168300..3168758 (-) 459 WP_135022262.1 YmfL family putative regulatory protein -
  WMR86_RS14980 (WMR86_14980) - 3168797..3169024 (-) 228 WP_036900931.1 helix-turn-helix transcriptional regulator -
  WMR86_RS14985 (WMR86_14985) - 3169120..3169794 (+) 675 WP_247850244.1 S24 family peptidase -
  WMR86_RS14990 (WMR86_14990) - 3169859..3170419 (+) 561 WP_247850245.1 hypothetical protein -
  WMR86_RS14995 (WMR86_14995) - 3170416..3171171 (+) 756 WP_247850246.1 DUF1828 domain-containing protein -
  WMR86_RS15000 (WMR86_15000) - 3171413..3171616 (+) 204 WP_247850247.1 hypothetical protein -
  WMR86_RS15005 (WMR86_15005) - 3171835..3172209 (+) 375 WP_006533955.1 hypothetical protein -
  WMR86_RS15010 (WMR86_15010) - 3172275..3173102 (+) 828 WP_340893626.1 DUF2303 family protein -
  WMR86_RS15015 (WMR86_15015) ssb 3173161..3173658 (+) 498 WP_100160156.1 single-stranded DNA-binding protein Machinery gene
  WMR86_RS15020 (WMR86_15020) - 3173732..3174442 (+) 711 WP_340893627.1 hypothetical protein -
  WMR86_RS15025 (WMR86_15025) - 3174489..3174961 (+) 473 Protein_2916 SAM-dependent methyltransferase -
  WMR86_RS15030 (WMR86_15030) - 3175015..3175203 (+) 189 WP_099660096.1 AlpA family phage regulatory protein -

Sequence


Protein


Download         Length: 165 a.a.        Molecular weight: 18115.58 Da        Isoelectric Point: 7.9707

>NTDB_id=970889 WMR86_RS15015 WP_100160156.1 3173161..3173658(+) (ssb) [Proteus vulgaris strain HJ90]
MANGSVNKVILIGNLGRDPEIRYLPSGGAVANLAVATSEKWRDKKTGENREKTEWHRVVLFGKLADIASGYLCKGSQIYI
EGQLQTREWDDNGVKRYATEIAVKVGGSMQMLGGASKSAGSQPAQQNQLPAQPQAQSNQPPMDFEDDIPFAPIGLMYPRY
FINML

Nucleotide


Download         Length: 498 bp        

>NTDB_id=970889 WMR86_RS15015 WP_100160156.1 3173161..3173658(+) (ssb) [Proteus vulgaris strain HJ90]
ATGGCTAACGGATCAGTAAACAAAGTAATTCTTATCGGCAATTTAGGGCGCGATCCTGAAATTCGCTACCTGCCTTCTGG
TGGTGCTGTTGCCAATTTAGCTGTGGCCACAAGTGAAAAATGGCGTGATAAAAAAACGGGTGAAAATCGCGAAAAAACAG
AATGGCATCGTGTTGTTTTGTTTGGAAAGCTGGCAGATATCGCAAGTGGCTATTTGTGCAAAGGCTCTCAAATTTATATT
GAGGGCCAACTACAAACGCGCGAGTGGGATGATAACGGCGTTAAACGCTATGCAACTGAAATTGCTGTAAAGGTTGGCGG
TTCAATGCAGATGTTAGGCGGTGCTAGTAAATCAGCAGGATCACAACCGGCACAGCAAAACCAACTACCAGCTCAACCTC
AAGCCCAAAGTAATCAGCCACCAATGGATTTTGAAGATGATATTCCTTTTGCTCCAATTGGACTTATGTATCCACGATAT
TTTATTAATATGCTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

57.627

100

0.618

  ssb Glaesserella parasuis strain SC1401

47.222

100

0.515

  ssb Neisseria meningitidis MC58

42.938

100

0.461

  ssb Neisseria gonorrhoeae MS11

42.938

100

0.461


Multiple sequence alignment