Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGD   Type   Machinery gene
Locus tag   SOZ35_RS12715 Genome accession   NZ_CP150480
Coordinates   2572243..2572608 (-) Length   121 a.a.
NCBI ID   WP_255265361.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain TL401     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2567243..2577608
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SOZ35_RS12665 (SOZ35_12665) sinI 2567411..2567584 (+) 174 WP_003325442.1 anti-repressor SinI family protein Regulator
  SOZ35_RS12670 (SOZ35_12670) sinR 2567618..2567953 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  SOZ35_RS12675 (SOZ35_12675) - 2568144..2568926 (-) 783 WP_212063621.1 TasA family protein -
  SOZ35_RS12680 (SOZ35_12680) - 2568990..2569562 (-) 573 WP_010789195.1 signal peptidase I -
  SOZ35_RS12685 (SOZ35_12685) tapA 2569546..2570247 (-) 702 WP_063638542.1 amyloid fiber anchoring/assembly protein TapA -
  SOZ35_RS12690 (SOZ35_12690) - 2570509..2570832 (+) 324 WP_003325436.1 DUF3889 domain-containing protein -
  SOZ35_RS12695 (SOZ35_12695) - 2570879..2571058 (-) 180 WP_003325435.1 YqzE family protein -
  SOZ35_RS12700 (SOZ35_12700) comGG 2571128..2571502 (-) 375 WP_340639515.1 competence type IV pilus minor pilin ComGG Machinery gene
  SOZ35_RS12705 (SOZ35_12705) comGF 2571503..2571898 (-) 396 WP_340640733.1 competence type IV pilus minor pilin ComGF Machinery gene
  SOZ35_RS12710 (SOZ35_12710) comGE 2571912..2572259 (-) 348 WP_340639516.1 competence type IV pilus minor pilin ComGE Machinery gene
  SOZ35_RS12715 (SOZ35_12715) comGD 2572243..2572608 (-) 366 WP_255265361.1 competence type IV pilus minor pilin ComGD Machinery gene
  SOZ35_RS12720 (SOZ35_12720) comGC 2572673..2572981 (-) 309 WP_087941811.1 competence type IV pilus major pilin ComGC Machinery gene
  SOZ35_RS12725 (SOZ35_12725) comGB 2572987..2574024 (-) 1038 WP_061669999.1 competence type IV pilus assembly protein ComGB Machinery gene
  SOZ35_RS12730 (SOZ35_12730) comGA 2574011..2575081 (-) 1071 WP_063638548.1 competence type IV pilus ATPase ComGA Machinery gene
  SOZ35_RS12735 (SOZ35_12735) - 2575471..2576424 (-) 954 WP_003325425.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 121 a.a.        Molecular weight: 13921.22 Da        Isoelectric Point: 9.4190

>NTDB_id=970491 SOZ35_RS12715 WP_255265361.1 2572243..2572608(-) (comGD) [Bacillus atrophaeus strain TL401]
MLICVFTVIPPVYKNTSARQTVARLESDILLAQQTAISKHERVRIVFLSKEHKYQIIMGASIVERTYEDWIFIECATLAD
RLDFNEKGNPNLGGKIRLKTDRLTYEMTVYLGSGKINVERK

Nucleotide


Download         Length: 366 bp        

>NTDB_id=970491 SOZ35_RS12715 WP_255265361.1 2572243..2572608(-) (comGD) [Bacillus atrophaeus strain TL401]
ATGCTGATTTGTGTTTTTACAGTCATACCTCCCGTATATAAAAATACATCTGCCCGCCAAACTGTTGCCAGGCTTGAAAG
TGACATTCTCCTCGCTCAGCAGACTGCAATTTCTAAGCATGAGCGGGTGCGTATCGTGTTTTTGTCCAAGGAACATAAGT
ACCAGATCATTATGGGGGCTAGTATCGTCGAACGAACCTATGAGGATTGGATTTTCATTGAATGTGCAACATTGGCGGAC
CGTCTTGATTTTAATGAAAAAGGAAATCCGAATTTGGGCGGGAAAATCAGGCTGAAAACAGATCGCCTCACATATGAAAT
GACTGTCTACTTAGGGAGCGGAAAAATCAATGTGGAAAGAAAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

53.782

98.347

0.529

Multiple sequence alignment