Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   SOZ35_RS12705 Genome accession   NZ_CP150480
Coordinates   2571503..2571898 (-) Length   131 a.a.
NCBI ID   WP_340640733.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain TL401     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2566503..2576898
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SOZ35_RS12665 (SOZ35_12665) sinI 2567411..2567584 (+) 174 WP_003325442.1 anti-repressor SinI family protein Regulator
  SOZ35_RS12670 (SOZ35_12670) sinR 2567618..2567953 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  SOZ35_RS12675 (SOZ35_12675) - 2568144..2568926 (-) 783 WP_212063621.1 TasA family protein -
  SOZ35_RS12680 (SOZ35_12680) - 2568990..2569562 (-) 573 WP_010789195.1 signal peptidase I -
  SOZ35_RS12685 (SOZ35_12685) tapA 2569546..2570247 (-) 702 WP_063638542.1 amyloid fiber anchoring/assembly protein TapA -
  SOZ35_RS12690 (SOZ35_12690) - 2570509..2570832 (+) 324 WP_003325436.1 DUF3889 domain-containing protein -
  SOZ35_RS12695 (SOZ35_12695) - 2570879..2571058 (-) 180 WP_003325435.1 YqzE family protein -
  SOZ35_RS12700 (SOZ35_12700) comGG 2571128..2571502 (-) 375 WP_340639515.1 competence type IV pilus minor pilin ComGG Machinery gene
  SOZ35_RS12705 (SOZ35_12705) comGF 2571503..2571898 (-) 396 WP_340640733.1 competence type IV pilus minor pilin ComGF Machinery gene
  SOZ35_RS12710 (SOZ35_12710) comGE 2571912..2572259 (-) 348 WP_340639516.1 competence type IV pilus minor pilin ComGE Machinery gene
  SOZ35_RS12715 (SOZ35_12715) comGD 2572243..2572608 (-) 366 WP_255265361.1 competence type IV pilus minor pilin ComGD Machinery gene
  SOZ35_RS12720 (SOZ35_12720) comGC 2572673..2572981 (-) 309 WP_087941811.1 competence type IV pilus major pilin ComGC Machinery gene
  SOZ35_RS12725 (SOZ35_12725) comGB 2572987..2574024 (-) 1038 WP_061669999.1 competence type IV pilus assembly protein ComGB Machinery gene
  SOZ35_RS12730 (SOZ35_12730) comGA 2574011..2575081 (-) 1071 WP_063638548.1 competence type IV pilus ATPase ComGA Machinery gene
  SOZ35_RS12735 (SOZ35_12735) - 2575471..2576424 (-) 954 WP_003325425.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 131 a.a.        Molecular weight: 14824.23 Da        Isoelectric Point: 8.9847

>NTDB_id=970489 SOZ35_RS12705 WP_340640733.1 2571503..2571898(-) (comGF) [Bacillus atrophaeus strain TL401]
MSVYLLISGSLAMIFYQFLSRQLEGEGVKQEEWIISVEQMMNECKQAESVQLTDKGGGVLCRNGSGREILFEKYHKMIRK
RVDGKGHVPILQHINTLKADIKNGMLILSVTSENHKEYKTSFPIYTSLKGG

Nucleotide


Download         Length: 396 bp        

>NTDB_id=970489 SOZ35_RS12705 WP_340640733.1 2571503..2571898(-) (comGF) [Bacillus atrophaeus strain TL401]
CTGTCAGTTTATCTGCTCATATCAGGATCTTTAGCCATGATCTTTTATCAGTTTTTATCCCGTCAACTGGAGGGAGAGGG
AGTCAAGCAGGAGGAATGGATCATTTCCGTTGAGCAAATGATGAATGAATGTAAGCAGGCTGAGAGTGTGCAGCTGACTG
ATAAGGGCGGCGGTGTGCTGTGCAGGAATGGTTCAGGCCGAGAGATTCTTTTTGAAAAATATCATAAAATGATCAGGAAA
AGAGTGGACGGTAAAGGGCATGTCCCGATTCTTCAGCATATTAACACATTGAAAGCTGATATAAAAAACGGCATGCTGAT
CTTGAGCGTAACAAGTGAAAACCATAAAGAGTATAAAACCTCTTTTCCTATTTATACATCATTGAAAGGAGGATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

57.48

96.947

0.557


Multiple sequence alignment