Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   SOZ35_RS12665 Genome accession   NZ_CP150480
Coordinates   2567411..2567584 (+) Length   57 a.a.
NCBI ID   WP_003325442.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain TL401     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2562411..2572584
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SOZ35_RS12650 (SOZ35_12650) gcvT 2563180..2564274 (-) 1095 WP_003325445.1 glycine cleavage system aminomethyltransferase GcvT -
  SOZ35_RS12655 (SOZ35_12655) - 2564735..2566405 (+) 1671 WP_340639513.1 SNF2-related protein -
  SOZ35_RS12660 (SOZ35_12660) - 2566426..2567220 (+) 795 WP_340639514.1 YqhG family protein -
  SOZ35_RS12665 (SOZ35_12665) sinI 2567411..2567584 (+) 174 WP_003325442.1 anti-repressor SinI family protein Regulator
  SOZ35_RS12670 (SOZ35_12670) sinR 2567618..2567953 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  SOZ35_RS12675 (SOZ35_12675) - 2568144..2568926 (-) 783 WP_212063621.1 TasA family protein -
  SOZ35_RS12680 (SOZ35_12680) - 2568990..2569562 (-) 573 WP_010789195.1 signal peptidase I -
  SOZ35_RS12685 (SOZ35_12685) tapA 2569546..2570247 (-) 702 WP_063638542.1 amyloid fiber anchoring/assembly protein TapA -
  SOZ35_RS12690 (SOZ35_12690) - 2570509..2570832 (+) 324 WP_003325436.1 DUF3889 domain-containing protein -
  SOZ35_RS12695 (SOZ35_12695) - 2570879..2571058 (-) 180 WP_003325435.1 YqzE family protein -
  SOZ35_RS12700 (SOZ35_12700) comGG 2571128..2571502 (-) 375 WP_340639515.1 competence type IV pilus minor pilin ComGG Machinery gene
  SOZ35_RS12705 (SOZ35_12705) comGF 2571503..2571898 (-) 396 WP_340640733.1 competence type IV pilus minor pilin ComGF Machinery gene
  SOZ35_RS12710 (SOZ35_12710) comGE 2571912..2572259 (-) 348 WP_340639516.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6813.90 Da        Isoelectric Point: 10.0469

>NTDB_id=970486 SOZ35_RS12665 WP_003325442.1 2567411..2567584(+) (sinI) [Bacillus atrophaeus strain TL401]
MKNAKKELLELDQEWVELMKRAREANINPEEIRKYLYLHKKSAHPVPATRSHTINPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=970486 SOZ35_RS12665 WP_003325442.1 2567411..2567584(+) (sinI) [Bacillus atrophaeus strain TL401]
ATGAAAAATGCAAAAAAAGAGCTTTTAGAATTAGATCAAGAATGGGTTGAATTAATGAAAAGAGCCAGAGAAGCAAATAT
CAACCCGGAGGAGATACGCAAATATTTATATTTGCATAAAAAGTCTGCTCATCCTGTCCCAGCCACCAGAAGTCATACCA
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

78.947

100

0.789

Multiple sequence alignment