Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MHH79_RS16295 Genome accession   NZ_CP150275
Coordinates   3120480..3120620 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. FSL K6-0993     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3115480..3125620
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHH79_RS16270 (MHH79_16270) - 3115795..3116175 (-) 381 WP_015483631.1 hotdog fold thioesterase -
  MHH79_RS16275 (MHH79_16275) comA 3116193..3116837 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  MHH79_RS16280 (MHH79_16280) comP 3116918..3119227 (-) 2310 WP_340034721.1 two-component system sensor histidine kinase ComP Regulator
  MHH79_RS16285 (MHH79_16285) comX 3119242..3119409 (-) 168 WP_100505762.1 competence pheromone ComX Regulator
  MHH79_RS16290 (MHH79_16290) comQ 3119393..3120295 (-) 903 WP_100505763.1 polyprenyl synthetase family protein Regulator
  MHH79_RS16295 (MHH79_16295) degQ 3120480..3120620 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  MHH79_RS16300 (MHH79_16300) - 3120842..3120967 (+) 126 WP_154796978.1 hypothetical protein -
  MHH79_RS16305 (MHH79_16305) - 3121082..3121450 (+) 369 WP_015483634.1 hypothetical protein -
  MHH79_RS16310 (MHH79_16310) pdeH 3121426..3122655 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  MHH79_RS16315 (MHH79_16315) - 3122792..3124264 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  MHH79_RS16320 (MHH79_16320) - 3124280..3124831 (-) 552 WP_251217615.1 isochorismatase family cysteine hydrolase -
  MHH79_RS16325 (MHH79_16325) - 3124928..3125326 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=969135 MHH79_RS16295 WP_003220708.1 3120480..3120620(-) (degQ) [Bacillus sp. FSL K6-0993]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=969135 MHH79_RS16295 WP_003220708.1 3120480..3120620(-) (degQ) [Bacillus sp. FSL K6-0993]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment