Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   MHH79_RS16285 Genome accession   NZ_CP150275
Coordinates   3119242..3119409 (-) Length   55 a.a.
NCBI ID   WP_100505762.1    Uniprot ID   -
Organism   Bacillus sp. FSL K6-0993     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3114242..3124409
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHH79_RS16255 (MHH79_16255) - 3114638..3115114 (+) 477 WP_003228815.1 Na+/H+ antiporter subunit E -
  MHH79_RS16260 (MHH79_16260) - 3115114..3115398 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  MHH79_RS16265 (MHH79_16265) mnhG 3115382..3115756 (+) 375 WP_014477830.1 monovalent cation/H(+) antiporter subunit G -
  MHH79_RS16270 (MHH79_16270) - 3115795..3116175 (-) 381 WP_015483631.1 hotdog fold thioesterase -
  MHH79_RS16275 (MHH79_16275) comA 3116193..3116837 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  MHH79_RS16280 (MHH79_16280) comP 3116918..3119227 (-) 2310 WP_340034721.1 two-component system sensor histidine kinase ComP Regulator
  MHH79_RS16285 (MHH79_16285) comX 3119242..3119409 (-) 168 WP_100505762.1 competence pheromone ComX Regulator
  MHH79_RS16290 (MHH79_16290) comQ 3119393..3120295 (-) 903 WP_100505763.1 polyprenyl synthetase family protein Regulator
  MHH79_RS16295 (MHH79_16295) degQ 3120480..3120620 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  MHH79_RS16300 (MHH79_16300) - 3120842..3120967 (+) 126 WP_154796978.1 hypothetical protein -
  MHH79_RS16305 (MHH79_16305) - 3121082..3121450 (+) 369 WP_015483634.1 hypothetical protein -
  MHH79_RS16310 (MHH79_16310) pdeH 3121426..3122655 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  MHH79_RS16315 (MHH79_16315) - 3122792..3124264 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6505.42 Da        Isoelectric Point: 4.3494

>NTDB_id=969133 MHH79_RS16285 WP_100505762.1 3119242..3119409(-) (comX) [Bacillus sp. FSL K6-0993]
MQDLINYFLNYPEVLKKLKNKEACLIGFDVQETETIIKAYNDYYLSGPITREWDG

Nucleotide


Download         Length: 168 bp        

>NTDB_id=969133 MHH79_RS16285 WP_100505762.1 3119242..3119409(-) (comX) [Bacillus sp. FSL K6-0993]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGTTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATTTGTCTGGCCCAATAACCCGTGAATGGG
ATGGTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

92.453

96.364

0.891

Multiple sequence alignment